Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7MNQ1

Protein Details
Accession A0A0B7MNQ1    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
151-179PQTMKRESGRRQQQRNKYEKRHKPCCGAGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 10, cyto 4.5, plas 3, pero 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MYFKEARKEGIENDYSNSSNATVNMESVHNYNKRQSELEFKEQPLQKRRVRRMGIEEEEEFFEEMEEEEKDEEERTVFIQLIHPTFDFAEIRKGRRLKSYLVLQDPPYPSWLIMRFIELLVSITVVAAIAVSAAPLGGKDIVDTNKMVFDPQTMKRESGRRQQQRNKYEKRHKPCCGAGLGLGLDAQARLDLGGNAAAGTAVNPPVAANAAANAGAAANAAVPAPAPGDTINVRVENNHSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.35
3 0.32
4 0.29
5 0.21
6 0.18
7 0.18
8 0.18
9 0.15
10 0.14
11 0.16
12 0.15
13 0.16
14 0.16
15 0.23
16 0.23
17 0.26
18 0.32
19 0.34
20 0.36
21 0.37
22 0.38
23 0.41
24 0.44
25 0.51
26 0.49
27 0.47
28 0.53
29 0.55
30 0.61
31 0.59
32 0.61
33 0.58
34 0.64
35 0.71
36 0.73
37 0.73
38 0.71
39 0.7
40 0.71
41 0.7
42 0.63
43 0.55
44 0.47
45 0.43
46 0.37
47 0.28
48 0.19
49 0.14
50 0.09
51 0.08
52 0.08
53 0.07
54 0.07
55 0.07
56 0.07
57 0.08
58 0.08
59 0.08
60 0.07
61 0.08
62 0.08
63 0.08
64 0.08
65 0.08
66 0.12
67 0.14
68 0.14
69 0.15
70 0.15
71 0.14
72 0.14
73 0.15
74 0.12
75 0.1
76 0.19
77 0.2
78 0.22
79 0.28
80 0.31
81 0.31
82 0.38
83 0.4
84 0.34
85 0.37
86 0.43
87 0.42
88 0.43
89 0.43
90 0.37
91 0.4
92 0.38
93 0.33
94 0.26
95 0.21
96 0.17
97 0.17
98 0.17
99 0.14
100 0.13
101 0.14
102 0.13
103 0.12
104 0.12
105 0.09
106 0.08
107 0.06
108 0.06
109 0.04
110 0.03
111 0.03
112 0.03
113 0.03
114 0.02
115 0.02
116 0.02
117 0.02
118 0.02
119 0.02
120 0.02
121 0.02
122 0.02
123 0.03
124 0.03
125 0.03
126 0.04
127 0.06
128 0.07
129 0.09
130 0.09
131 0.09
132 0.1
133 0.1
134 0.1
135 0.08
136 0.1
137 0.14
138 0.19
139 0.24
140 0.24
141 0.26
142 0.3
143 0.37
144 0.41
145 0.46
146 0.52
147 0.56
148 0.65
149 0.73
150 0.79
151 0.82
152 0.86
153 0.86
154 0.86
155 0.88
156 0.88
157 0.88
158 0.89
159 0.84
160 0.81
161 0.76
162 0.69
163 0.61
164 0.51
165 0.42
166 0.34
167 0.27
168 0.2
169 0.15
170 0.11
171 0.08
172 0.07
173 0.06
174 0.03
175 0.03
176 0.03
177 0.04
178 0.04
179 0.05
180 0.06
181 0.06
182 0.06
183 0.06
184 0.05
185 0.04
186 0.05
187 0.06
188 0.06
189 0.06
190 0.06
191 0.06
192 0.07
193 0.08
194 0.08
195 0.06
196 0.07
197 0.07
198 0.07
199 0.07
200 0.07
201 0.05
202 0.05
203 0.05
204 0.04
205 0.03
206 0.04
207 0.04
208 0.04
209 0.04
210 0.04
211 0.05
212 0.06
213 0.07
214 0.07
215 0.11
216 0.12
217 0.15
218 0.18
219 0.19
220 0.19
221 0.2