Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7NTD3

Protein Details
Accession A0A0B7NTD3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
79-100APKETRNKRRIIKSFKIHPHVCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, extr 6, cyto 5.5, cyto_nucl 4, plas 3
Family & Domain DBs
Amino Acid Sequences MTRQAPPVPIHRPTIDISLALIFARSIASRSTTSIKLLQQKLAFLLAMAAFLRPSDLARIPYVSCSITDGGCFNFNVVAPKETRNKRRIIKSFKIHPHVCPMLNFVRYNASRLFAITLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.32
3 0.25
4 0.22
5 0.18
6 0.17
7 0.14
8 0.11
9 0.07
10 0.06
11 0.07
12 0.06
13 0.06
14 0.07
15 0.1
16 0.11
17 0.14
18 0.18
19 0.18
20 0.21
21 0.24
22 0.28
23 0.33
24 0.34
25 0.37
26 0.33
27 0.33
28 0.31
29 0.27
30 0.22
31 0.13
32 0.12
33 0.07
34 0.07
35 0.06
36 0.05
37 0.05
38 0.05
39 0.05
40 0.04
41 0.04
42 0.06
43 0.08
44 0.09
45 0.1
46 0.12
47 0.11
48 0.12
49 0.13
50 0.11
51 0.09
52 0.1
53 0.1
54 0.09
55 0.09
56 0.09
57 0.08
58 0.09
59 0.09
60 0.08
61 0.07
62 0.08
63 0.11
64 0.12
65 0.13
66 0.13
67 0.18
68 0.27
69 0.35
70 0.43
71 0.45
72 0.52
73 0.58
74 0.67
75 0.73
76 0.74
77 0.75
78 0.76
79 0.81
80 0.82
81 0.83
82 0.75
83 0.67
84 0.66
85 0.61
86 0.54
87 0.45
88 0.41
89 0.38
90 0.4
91 0.38
92 0.3
93 0.34
94 0.33
95 0.36
96 0.32
97 0.28
98 0.24
99 0.25