Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7NLD9

Protein Details
Accession A0A0B7NLD9    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MTCKRRNNGRNKHGRGHTKYVRCBasic
87-107RSAIDRRNRLPPPRFRFQKKAHydrophilic
NLS Segment(s)
PositionSequence
95-106RLPPPRFRFQKK
Subcellular Location(s) mito 15, nucl 7, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MTCKRRNNGRNKHGRGHTKYVRCINCYRCVPKDKAIKRFTIRNMVEAAAVRDLQEASIYEEYAIPKLYVKLHYCISCAIHARVVRVRSAIDRRNRLPPPRFRFQKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.83
3 0.82
4 0.8
5 0.77
6 0.77
7 0.77
8 0.72
9 0.67
10 0.66
11 0.61
12 0.61
13 0.61
14 0.59
15 0.56
16 0.58
17 0.58
18 0.58
19 0.64
20 0.62
21 0.65
22 0.62
23 0.63
24 0.6
25 0.63
26 0.59
27 0.59
28 0.52
29 0.44
30 0.41
31 0.34
32 0.31
33 0.24
34 0.21
35 0.12
36 0.11
37 0.09
38 0.08
39 0.07
40 0.06
41 0.06
42 0.06
43 0.08
44 0.08
45 0.08
46 0.08
47 0.09
48 0.1
49 0.1
50 0.1
51 0.07
52 0.07
53 0.09
54 0.11
55 0.15
56 0.17
57 0.19
58 0.23
59 0.24
60 0.24
61 0.24
62 0.24
63 0.22
64 0.23
65 0.22
66 0.22
67 0.23
68 0.25
69 0.28
70 0.28
71 0.26
72 0.24
73 0.24
74 0.27
75 0.35
76 0.39
77 0.44
78 0.51
79 0.53
80 0.62
81 0.68
82 0.7
83 0.71
84 0.74
85 0.73
86 0.76
87 0.82