Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0B7NKK8

Protein Details
Accession A0A0B7NKK8    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
114-137LTPFEKSKKTVREQKKLAHFPLRKHydrophilic
NLS Segment(s)
PositionSequence
104-132VKKTRAMRRALTPFEKSKKTVREQKKLAH
Subcellular Location(s) nucl 14, mito 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MARIKGKLLKTGIDSRRFMRPACAAIKAHELRNKNKAELVKILDEQKQQLANIRVQKVAGGKLQEIGEARKNVARVLTVINQTQREQLRLFYQKKRFTPLDLRVKKTRAMRRALTPFEKSKKTVREQKKLAHFPLRKYAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.48
3 0.55
4 0.53
5 0.48
6 0.44
7 0.4
8 0.38
9 0.38
10 0.41
11 0.33
12 0.34
13 0.42
14 0.39
15 0.41
16 0.4
17 0.42
18 0.43
19 0.5
20 0.51
21 0.43
22 0.45
23 0.42
24 0.4
25 0.4
26 0.38
27 0.33
28 0.32
29 0.35
30 0.34
31 0.33
32 0.3
33 0.27
34 0.25
35 0.22
36 0.25
37 0.25
38 0.25
39 0.3
40 0.31
41 0.28
42 0.26
43 0.28
44 0.23
45 0.23
46 0.2
47 0.15
48 0.13
49 0.15
50 0.15
51 0.15
52 0.14
53 0.14
54 0.16
55 0.15
56 0.16
57 0.15
58 0.15
59 0.14
60 0.14
61 0.12
62 0.09
63 0.11
64 0.14
65 0.15
66 0.16
67 0.19
68 0.2
69 0.2
70 0.24
71 0.22
72 0.21
73 0.2
74 0.2
75 0.24
76 0.31
77 0.36
78 0.4
79 0.48
80 0.53
81 0.55
82 0.6
83 0.55
84 0.52
85 0.56
86 0.57
87 0.59
88 0.59
89 0.62
90 0.62
91 0.62
92 0.62
93 0.62
94 0.61
95 0.57
96 0.58
97 0.56
98 0.59
99 0.66
100 0.68
101 0.64
102 0.61
103 0.62
104 0.62
105 0.62
106 0.56
107 0.56
108 0.58
109 0.62
110 0.66
111 0.68
112 0.72
113 0.75
114 0.81
115 0.83
116 0.83
117 0.8
118 0.8
119 0.75
120 0.7
121 0.74
122 0.72