Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9DF13

Protein Details
Accession E9DF13   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MDVSRRSPPRHLTRSRPTSSKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14.5, mito_nucl 12.166, nucl 8.5, cyto_nucl 6.833
Family & Domain DBs
Amino Acid Sequences MDVSRRSPPRHLTRSRPTSSKLVHFYISLPSSGQRRLTRSLENRASKNPTVHFKRTMMPKYRGTPYRATSIRPCQDIQVHKRSVTRKFTIKSPPQPSRLPLFDLSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.81
3 0.75
4 0.69
5 0.68
6 0.64
7 0.62
8 0.56
9 0.49
10 0.44
11 0.4
12 0.37
13 0.34
14 0.3
15 0.22
16 0.18
17 0.17
18 0.19
19 0.21
20 0.27
21 0.24
22 0.27
23 0.33
24 0.36
25 0.41
26 0.44
27 0.51
28 0.53
29 0.54
30 0.53
31 0.52
32 0.54
33 0.48
34 0.46
35 0.4
36 0.4
37 0.42
38 0.43
39 0.42
40 0.38
41 0.4
42 0.45
43 0.49
44 0.47
45 0.46
46 0.48
47 0.49
48 0.54
49 0.54
50 0.5
51 0.48
52 0.43
53 0.47
54 0.43
55 0.42
56 0.42
57 0.47
58 0.47
59 0.44
60 0.42
61 0.36
62 0.42
63 0.47
64 0.48
65 0.47
66 0.46
67 0.46
68 0.51
69 0.54
70 0.56
71 0.55
72 0.54
73 0.53
74 0.53
75 0.58
76 0.63
77 0.67
78 0.68
79 0.7
80 0.72
81 0.7
82 0.72
83 0.69
84 0.66
85 0.6
86 0.54