Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0B7NRT7

Protein Details
Accession A0A0B7NRT7    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
92-113WHKSRKIKYTSDGKRRKPLKEVBasic
NLS Segment(s)
PositionSequence
104-108GKRRK
Subcellular Location(s) nucl 20.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MSNNLQPPGSPLSSLSPPSPFQPTDSTDQKTIYDVLYSPDNPSEFYGPHQLIQSGACPHVVKLKQKIKENDGNQDANILENYRSLIQYSILWHKSRKIKYTSDGKRRKPLKEVSII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.26
3 0.24
4 0.24
5 0.26
6 0.3
7 0.25
8 0.25
9 0.27
10 0.29
11 0.32
12 0.37
13 0.37
14 0.34
15 0.35
16 0.32
17 0.29
18 0.26
19 0.2
20 0.15
21 0.12
22 0.12
23 0.14
24 0.14
25 0.14
26 0.15
27 0.15
28 0.15
29 0.16
30 0.15
31 0.12
32 0.14
33 0.19
34 0.17
35 0.18
36 0.17
37 0.16
38 0.15
39 0.15
40 0.15
41 0.1
42 0.1
43 0.1
44 0.1
45 0.1
46 0.16
47 0.19
48 0.21
49 0.29
50 0.36
51 0.4
52 0.48
53 0.52
54 0.52
55 0.58
56 0.57
57 0.55
58 0.53
59 0.48
60 0.4
61 0.37
62 0.3
63 0.23
64 0.2
65 0.13
66 0.09
67 0.08
68 0.1
69 0.09
70 0.09
71 0.09
72 0.1
73 0.09
74 0.11
75 0.14
76 0.21
77 0.24
78 0.26
79 0.27
80 0.34
81 0.43
82 0.48
83 0.52
84 0.5
85 0.52
86 0.58
87 0.68
88 0.71
89 0.73
90 0.77
91 0.77
92 0.81
93 0.83
94 0.81
95 0.79
96 0.78