Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7MVK7

Protein Details
Accession A0A0B7MVK7    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
58-86NNNSRTSSSVQQRRKKKTRWVRYETSGSSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences MRQQQCLNAQMQLRIATNNIAKSSLPGFPTVSSPMQPLTPQPFQPPIVIKPTVAMNNNNNSRTSSSVQQRRKKKTRWVRYETSGSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.21
4 0.22
5 0.22
6 0.21
7 0.19
8 0.18
9 0.19
10 0.21
11 0.19
12 0.17
13 0.16
14 0.16
15 0.15
16 0.17
17 0.19
18 0.18
19 0.15
20 0.15
21 0.14
22 0.14
23 0.13
24 0.14
25 0.17
26 0.18
27 0.18
28 0.2
29 0.22
30 0.23
31 0.24
32 0.24
33 0.2
34 0.22
35 0.22
36 0.19
37 0.17
38 0.19
39 0.21
40 0.21
41 0.23
42 0.22
43 0.3
44 0.36
45 0.36
46 0.34
47 0.32
48 0.32
49 0.33
50 0.32
51 0.31
52 0.36
53 0.45
54 0.54
55 0.61
56 0.69
57 0.75
58 0.82
59 0.83
60 0.84
61 0.86
62 0.87
63 0.89
64 0.88
65 0.86
66 0.84