Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7MQR1

Protein Details
Accession A0A0B7MQR1   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
41-62LTDVRRKIGKKRKQAQSHLWTWHydrophilic
NLS Segment(s)
PositionSequence
46-53RKIGKKRK
Subcellular Location(s) mito 16.5, cyto_mito 11.5, cyto 5.5, nucl 3
Family & Domain DBs
Amino Acid Sequences MRFKFNDTAFSDRSSAPMSSRYIIAVKLGPAYRALKIAGYLTDVRRKIGKKRKQAQSHLWTWLRTPLVLRHFVSGGAVLVQDKIAC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.24
3 0.19
4 0.22
5 0.21
6 0.2
7 0.2
8 0.2
9 0.18
10 0.17
11 0.17
12 0.14
13 0.12
14 0.15
15 0.15
16 0.13
17 0.15
18 0.17
19 0.16
20 0.16
21 0.15
22 0.12
23 0.12
24 0.12
25 0.09
26 0.1
27 0.12
28 0.12
29 0.18
30 0.18
31 0.19
32 0.23
33 0.25
34 0.32
35 0.41
36 0.48
37 0.53
38 0.63
39 0.72
40 0.77
41 0.82
42 0.83
43 0.8
44 0.76
45 0.74
46 0.66
47 0.57
48 0.48
49 0.46
50 0.36
51 0.29
52 0.27
53 0.25
54 0.27
55 0.33
56 0.33
57 0.3
58 0.29
59 0.28
60 0.27
61 0.21
62 0.16
63 0.1
64 0.1
65 0.08
66 0.08