Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0B7NK76

Protein Details
Accession A0A0B7NK76    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
59-83TFVVHAPKEKRKKRRIIKPFTIHPHBasic
NLS Segment(s)
PositionSequence
65-76PKEKRKKRRIIK
Subcellular Location(s) mito 14, nucl 9, cyto_nucl 7, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013762  Integrase-like_cat_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0015074  P:DNA integration  
GO:0006310  P:DNA recombination  
Amino Acid Sequences MDPSLAFARSIPSLRTTSVKQLQQKLTFLLAMAAFLRPSDLARIPFASCKIRESDGCLTFVVHAPKEKRKKRRIIKPFTIHPHNSDVELCPVHCFKALKDHPALSARPTGSNLFVKSNLIQQPLSASTLSTWLHRDFISLST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.27
3 0.27
4 0.33
5 0.39
6 0.45
7 0.48
8 0.55
9 0.61
10 0.61
11 0.6
12 0.52
13 0.46
14 0.39
15 0.31
16 0.25
17 0.16
18 0.13
19 0.11
20 0.1
21 0.08
22 0.07
23 0.08
24 0.06
25 0.07
26 0.1
27 0.12
28 0.13
29 0.15
30 0.17
31 0.17
32 0.19
33 0.22
34 0.23
35 0.21
36 0.21
37 0.22
38 0.23
39 0.22
40 0.26
41 0.3
42 0.27
43 0.27
44 0.26
45 0.23
46 0.22
47 0.24
48 0.2
49 0.13
50 0.16
51 0.18
52 0.27
53 0.37
54 0.45
55 0.52
56 0.59
57 0.69
58 0.75
59 0.82
60 0.84
61 0.84
62 0.86
63 0.83
64 0.82
65 0.79
66 0.76
67 0.66
68 0.58
69 0.52
70 0.43
71 0.36
72 0.29
73 0.23
74 0.19
75 0.18
76 0.16
77 0.13
78 0.13
79 0.13
80 0.15
81 0.15
82 0.12
83 0.23
84 0.25
85 0.28
86 0.31
87 0.31
88 0.32
89 0.35
90 0.35
91 0.27
92 0.3
93 0.26
94 0.24
95 0.26
96 0.23
97 0.24
98 0.27
99 0.27
100 0.24
101 0.24
102 0.24
103 0.23
104 0.29
105 0.28
106 0.27
107 0.25
108 0.23
109 0.26
110 0.25
111 0.26
112 0.19
113 0.15
114 0.13
115 0.18
116 0.18
117 0.17
118 0.19
119 0.18
120 0.21
121 0.2
122 0.21