Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7NP66

Protein Details
Accession A0A0B7NP66   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
60-79IKNSRDKRAKKLCKAKLGSFHydrophilic
NLS Segment(s)
PositionSequence
64-85RDKRAKKLCKAKLGSFVRAKKK
Subcellular Location(s) mito 20.5, cyto_mito 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MAASGIAVGLNKGHIVTRRVLKAKPSNKIGAASKRATFVRSIVREVSGYAPYERRVMELIKNSRDKRAKKLCKAKLGSFVRAKKKIDELSGVIAQARRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.16
3 0.21
4 0.27
5 0.35
6 0.38
7 0.4
8 0.46
9 0.52
10 0.57
11 0.59
12 0.58
13 0.55
14 0.53
15 0.55
16 0.53
17 0.5
18 0.49
19 0.44
20 0.39
21 0.38
22 0.37
23 0.33
24 0.28
25 0.23
26 0.25
27 0.24
28 0.25
29 0.23
30 0.23
31 0.22
32 0.22
33 0.21
34 0.14
35 0.13
36 0.12
37 0.12
38 0.12
39 0.14
40 0.13
41 0.12
42 0.12
43 0.13
44 0.16
45 0.23
46 0.27
47 0.32
48 0.4
49 0.4
50 0.47
51 0.54
52 0.53
53 0.56
54 0.62
55 0.66
56 0.68
57 0.78
58 0.78
59 0.8
60 0.83
61 0.77
62 0.76
63 0.71
64 0.69
65 0.67
66 0.67
67 0.67
68 0.67
69 0.65
70 0.59
71 0.62
72 0.59
73 0.54
74 0.51
75 0.44
76 0.43
77 0.42
78 0.38
79 0.32