Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7NCI5

Protein Details
Accession A0A0B7NCI5    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
299-320KDGIRLEKETRRRSNDQKVTVCHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 7.5, extr 7, E.R. 7, cyto_nucl 6, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR023209  DAO  
IPR006076  FAD-dep_OxRdtase  
Gene Ontology GO:0003884  F:D-amino-acid oxidase activity  
GO:0071949  F:FAD binding  
GO:0046416  P:D-amino acid metabolic process  
Pfam View protein in Pfam  
PF01266  DAO  
Amino Acid Sequences MSEKIVVLGAGVTGLTSAISLLKKGYKDVIVASKHVPGDLSSEYTSPWAGASILTIADHDDYRLQEMDLHTMREFERLSREEPEANVMPCKGIQYCEDPTLPGEDPHWVRKIYKNVKEIPKNELIPGVSYGYTFESFTANVPKYLQWLVKTLISLGGRIERKSFESIQQAIEEFPEATVIVNCTGLGSYYLTDVKDHTMYPIRGQTVTVRAPHIKASIVHTQHYIDSSNRWTYIIPRNDGTVICGGTVDRINRNTAPDDSITKDILERVYKLYPEITHGKGPSHFDIVGVNVGFRPGRKDGIRLEKETRRRSNDQKVTVCHNYGHSSHGYQSSWGSCAKLVELVSNERLSKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.03
4 0.04
5 0.07
6 0.08
7 0.09
8 0.12
9 0.17
10 0.18
11 0.2
12 0.24
13 0.23
14 0.24
15 0.29
16 0.34
17 0.32
18 0.34
19 0.34
20 0.35
21 0.33
22 0.31
23 0.27
24 0.19
25 0.21
26 0.2
27 0.21
28 0.18
29 0.18
30 0.18
31 0.18
32 0.18
33 0.13
34 0.11
35 0.08
36 0.07
37 0.07
38 0.07
39 0.07
40 0.07
41 0.07
42 0.07
43 0.07
44 0.09
45 0.09
46 0.09
47 0.1
48 0.11
49 0.14
50 0.14
51 0.13
52 0.15
53 0.16
54 0.23
55 0.22
56 0.24
57 0.21
58 0.22
59 0.23
60 0.23
61 0.23
62 0.17
63 0.23
64 0.23
65 0.26
66 0.28
67 0.3
68 0.28
69 0.28
70 0.32
71 0.27
72 0.26
73 0.25
74 0.21
75 0.2
76 0.18
77 0.19
78 0.14
79 0.13
80 0.14
81 0.17
82 0.2
83 0.23
84 0.23
85 0.21
86 0.21
87 0.23
88 0.22
89 0.17
90 0.15
91 0.17
92 0.2
93 0.23
94 0.26
95 0.23
96 0.25
97 0.31
98 0.41
99 0.45
100 0.5
101 0.53
102 0.58
103 0.67
104 0.72
105 0.68
106 0.63
107 0.6
108 0.53
109 0.47
110 0.42
111 0.32
112 0.25
113 0.24
114 0.19
115 0.13
116 0.11
117 0.12
118 0.11
119 0.11
120 0.1
121 0.09
122 0.09
123 0.09
124 0.1
125 0.15
126 0.14
127 0.14
128 0.15
129 0.15
130 0.16
131 0.19
132 0.19
133 0.14
134 0.17
135 0.17
136 0.18
137 0.17
138 0.15
139 0.17
140 0.15
141 0.14
142 0.12
143 0.16
144 0.16
145 0.17
146 0.18
147 0.15
148 0.17
149 0.2
150 0.21
151 0.19
152 0.23
153 0.24
154 0.23
155 0.23
156 0.21
157 0.17
158 0.16
159 0.13
160 0.07
161 0.06
162 0.05
163 0.04
164 0.04
165 0.04
166 0.05
167 0.05
168 0.05
169 0.05
170 0.04
171 0.04
172 0.04
173 0.05
174 0.05
175 0.04
176 0.06
177 0.07
178 0.07
179 0.07
180 0.08
181 0.09
182 0.1
183 0.1
184 0.11
185 0.15
186 0.16
187 0.18
188 0.2
189 0.2
190 0.19
191 0.2
192 0.2
193 0.19
194 0.21
195 0.21
196 0.2
197 0.21
198 0.21
199 0.22
200 0.21
201 0.17
202 0.16
203 0.19
204 0.24
205 0.24
206 0.24
207 0.24
208 0.24
209 0.23
210 0.23
211 0.2
212 0.13
213 0.14
214 0.17
215 0.18
216 0.17
217 0.17
218 0.17
219 0.21
220 0.29
221 0.32
222 0.31
223 0.29
224 0.31
225 0.32
226 0.31
227 0.27
228 0.2
229 0.15
230 0.12
231 0.11
232 0.1
233 0.1
234 0.13
235 0.13
236 0.15
237 0.16
238 0.2
239 0.21
240 0.24
241 0.25
242 0.24
243 0.24
244 0.22
245 0.24
246 0.24
247 0.25
248 0.22
249 0.2
250 0.19
251 0.18
252 0.2
253 0.19
254 0.17
255 0.18
256 0.2
257 0.21
258 0.21
259 0.22
260 0.19
261 0.22
262 0.26
263 0.26
264 0.28
265 0.28
266 0.3
267 0.3
268 0.35
269 0.32
270 0.31
271 0.28
272 0.23
273 0.23
274 0.22
275 0.22
276 0.17
277 0.14
278 0.11
279 0.12
280 0.13
281 0.12
282 0.16
283 0.15
284 0.22
285 0.23
286 0.28
287 0.35
288 0.46
289 0.51
290 0.52
291 0.57
292 0.59
293 0.68
294 0.73
295 0.74
296 0.71
297 0.74
298 0.78
299 0.81
300 0.82
301 0.82
302 0.79
303 0.74
304 0.74
305 0.72
306 0.64
307 0.55
308 0.49
309 0.44
310 0.38
311 0.37
312 0.32
313 0.28
314 0.3
315 0.33
316 0.29
317 0.26
318 0.29
319 0.27
320 0.26
321 0.25
322 0.22
323 0.19
324 0.2
325 0.19
326 0.19
327 0.17
328 0.2
329 0.22
330 0.26
331 0.29
332 0.31