Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7N2N9

Protein Details
Accession A0A0B7N2N9   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
66-91LSGSKDDKREKLKKKAKNFLDERQKYBasic
NLS Segment(s)
PositionSequence
73-82KREKLKKKAK
Subcellular Location(s) mito 18.5, cyto_mito 10.5, nucl 6
Family & Domain DBs
Amino Acid Sequences MMRKAVSSSSTSRKGLSAATAAATTATEKSKSTLDDNQDYNNNKNNNINTLGLDVPILPSTSTFTLSGSKDDKREKLKKKAKNFLDERQKXXXXY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.3
3 0.27
4 0.2
5 0.15
6 0.15
7 0.13
8 0.12
9 0.11
10 0.1
11 0.09
12 0.08
13 0.09
14 0.09
15 0.1
16 0.11
17 0.13
18 0.15
19 0.18
20 0.22
21 0.26
22 0.3
23 0.3
24 0.31
25 0.35
26 0.35
27 0.34
28 0.35
29 0.31
30 0.27
31 0.3
32 0.28
33 0.25
34 0.25
35 0.23
36 0.17
37 0.17
38 0.16
39 0.12
40 0.12
41 0.09
42 0.07
43 0.07
44 0.07
45 0.05
46 0.05
47 0.08
48 0.08
49 0.1
50 0.1
51 0.1
52 0.15
53 0.15
54 0.19
55 0.21
56 0.23
57 0.28
58 0.34
59 0.4
60 0.46
61 0.55
62 0.61
63 0.68
64 0.75
65 0.78
66 0.83
67 0.87
68 0.85
69 0.86
70 0.84
71 0.83