Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0B7NXX9

Protein Details
Accession A0A0B7NXX9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
56-78TVKRRGKIFVTCNKNKKHKQRQGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
PROSITE View protein in PROSITE  
PS00828  RIBOSOMAL_L36  
Amino Acid Sequences MSLLSQFTKSAFQQFTRQQQPTLAAWQQAGNPSIFTLVRTMKVRSSVKKMCDGCSTVKRRGKIFVTCNKNKKHKQRQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.49
3 0.53
4 0.54
5 0.47
6 0.46
7 0.48
8 0.41
9 0.4
10 0.32
11 0.24
12 0.23
13 0.23
14 0.22
15 0.21
16 0.2
17 0.14
18 0.12
19 0.11
20 0.12
21 0.1
22 0.1
23 0.1
24 0.09
25 0.12
26 0.14
27 0.15
28 0.15
29 0.22
30 0.26
31 0.27
32 0.35
33 0.38
34 0.39
35 0.46
36 0.47
37 0.43
38 0.42
39 0.41
40 0.39
41 0.44
42 0.47
43 0.48
44 0.51
45 0.51
46 0.49
47 0.54
48 0.53
49 0.52
50 0.55
51 0.56
52 0.61
53 0.67
54 0.74
55 0.76
56 0.81
57 0.83
58 0.85