Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0B7NLX5

Protein Details
Accession A0A0B7NLX5    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
54-75KGTSHKPKKNLPKKDKGKGKASBasic
NLS Segment(s)
PositionSequence
57-74SHKPKKNLPKKDKGKGKA
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
Amino Acid Sequences MTRKKKPSSDQSGDSSSEHDDASSRKKRDNLVSQTTSTYFGAPPSVPSDMNIGKGTSHKPKKNLPKKDKGKGKASSSSPIPAAQQEAVTAQKKNKGKEKASILPPAAHNFQQVAPGPSTAPSNSTAVSTPADYFDAILSAMSPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.44
3 0.35
4 0.28
5 0.23
6 0.17
7 0.15
8 0.16
9 0.25
10 0.32
11 0.32
12 0.36
13 0.4
14 0.47
15 0.54
16 0.61
17 0.6
18 0.61
19 0.62
20 0.59
21 0.57
22 0.51
23 0.44
24 0.34
25 0.27
26 0.18
27 0.14
28 0.15
29 0.13
30 0.13
31 0.13
32 0.14
33 0.13
34 0.13
35 0.18
36 0.16
37 0.19
38 0.18
39 0.15
40 0.14
41 0.17
42 0.2
43 0.26
44 0.34
45 0.35
46 0.39
47 0.48
48 0.58
49 0.66
50 0.73
51 0.72
52 0.75
53 0.8
54 0.84
55 0.85
56 0.8
57 0.78
58 0.73
59 0.69
60 0.64
61 0.57
62 0.51
63 0.44
64 0.39
65 0.31
66 0.26
67 0.22
68 0.15
69 0.15
70 0.12
71 0.1
72 0.09
73 0.09
74 0.13
75 0.14
76 0.15
77 0.15
78 0.22
79 0.26
80 0.31
81 0.39
82 0.44
83 0.45
84 0.51
85 0.58
86 0.59
87 0.6
88 0.61
89 0.53
90 0.48
91 0.47
92 0.43
93 0.38
94 0.3
95 0.26
96 0.21
97 0.2
98 0.22
99 0.22
100 0.21
101 0.19
102 0.19
103 0.18
104 0.18
105 0.2
106 0.15
107 0.15
108 0.14
109 0.15
110 0.14
111 0.15
112 0.15
113 0.15
114 0.16
115 0.16
116 0.14
117 0.14
118 0.15
119 0.14
120 0.13
121 0.12
122 0.11
123 0.09
124 0.08