Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7NX96

Protein Details
Accession A0A0B7NX96   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
51-70APKTVNWRKSAARKEKRSKQHydrophilic
NLS Segment(s)
PositionSequence
61-73RKSAARKEKRSKQ
Subcellular Location(s) mito 12, cyto 8, nucl 7
Family & Domain DBs
Amino Acid Sequences MRSXXXLYKVHGKGFDDPIEHTWEPVENFDSTKHIELYWGRRGGAKATCKLQLAPKTVNWRKSAARKEKRSKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.34
3 0.35
4 0.32
5 0.26
6 0.22
7 0.2
8 0.2
9 0.19
10 0.19
11 0.11
12 0.12
13 0.13
14 0.14
15 0.14
16 0.15
17 0.14
18 0.11
19 0.14
20 0.16
21 0.2
22 0.24
23 0.24
24 0.23
25 0.24
26 0.25
27 0.26
28 0.29
29 0.29
30 0.26
31 0.28
32 0.3
33 0.29
34 0.3
35 0.34
36 0.35
37 0.35
38 0.35
39 0.37
40 0.46
41 0.51
42 0.56
43 0.51
44 0.49
45 0.52
46 0.58
47 0.64
48 0.65
49 0.69
50 0.74