Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9D9B7

Protein Details
Accession E9D9B7   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MGNTRLQYRRRNPYKTRSNKVRVIKTPHydrophilic
NLS Segment(s)
PositionSequence
119-119K
Subcellular Location(s) nucl 13, mito 8, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
IPR018065  Ribosomal_L34e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
PROSITE View protein in PROSITE  
PS01145  RIBOSOMAL_L34E  
Amino Acid Sequences MGNTRLQYRRRNPYKTRSNKVRVIKTPGGELRYLHIKKKGTAPKCGDCGIKLPGIPALRPREYSQISRPKKNVTRAYGGSRCGNCVKDRIVRAFLIEEQKIVKKVLKESQEKAAASAKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.87
3 0.88
4 0.87
5 0.86
6 0.85
7 0.85
8 0.84
9 0.8
10 0.79
11 0.73
12 0.64
13 0.63
14 0.58
15 0.51
16 0.42
17 0.36
18 0.3
19 0.35
20 0.35
21 0.32
22 0.33
23 0.33
24 0.34
25 0.44
26 0.49
27 0.43
28 0.51
29 0.54
30 0.53
31 0.54
32 0.54
33 0.45
34 0.36
35 0.36
36 0.29
37 0.23
38 0.18
39 0.15
40 0.16
41 0.16
42 0.16
43 0.18
44 0.21
45 0.21
46 0.23
47 0.24
48 0.27
49 0.29
50 0.32
51 0.35
52 0.4
53 0.44
54 0.48
55 0.49
56 0.51
57 0.55
58 0.61
59 0.61
60 0.55
61 0.57
62 0.54
63 0.6
64 0.55
65 0.51
66 0.48
67 0.4
68 0.39
69 0.35
70 0.34
71 0.27
72 0.28
73 0.3
74 0.3
75 0.34
76 0.35
77 0.35
78 0.33
79 0.33
80 0.31
81 0.31
82 0.31
83 0.27
84 0.23
85 0.23
86 0.26
87 0.27
88 0.26
89 0.26
90 0.23
91 0.3
92 0.36
93 0.43
94 0.46
95 0.48
96 0.55
97 0.58
98 0.55
99 0.51
100 0.51