Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7NUW4

Protein Details
Accession A0A0B7NUW4   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
3-31FLPYNKDPEKKIPTKKTNRTANRPPTQLNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 10.5, mito 6, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MRFLPYNKDPEKKIPTKKTNRTANRPPTQLNEKHKAYLTDFYDENPTATIQDAVNKLVENFEGLTIKKSRVAEFMKDECNLSLKVVTRHPVARNSERTLQLRKEFVEEWIQQKGVLYMQNCVFLDESGFDVNMRHSRGWSKKGNEAIRRNTIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.77
3 0.82
4 0.89
5 0.89
6 0.89
7 0.9
8 0.89
9 0.89
10 0.89
11 0.86
12 0.81
13 0.74
14 0.71
15 0.7
16 0.68
17 0.66
18 0.64
19 0.58
20 0.56
21 0.55
22 0.51
23 0.44
24 0.43
25 0.37
26 0.32
27 0.29
28 0.27
29 0.3
30 0.27
31 0.24
32 0.17
33 0.15
34 0.12
35 0.12
36 0.12
37 0.08
38 0.12
39 0.12
40 0.13
41 0.13
42 0.13
43 0.12
44 0.11
45 0.11
46 0.07
47 0.07
48 0.07
49 0.08
50 0.08
51 0.11
52 0.12
53 0.12
54 0.15
55 0.16
56 0.16
57 0.21
58 0.23
59 0.24
60 0.28
61 0.3
62 0.28
63 0.28
64 0.27
65 0.21
66 0.2
67 0.17
68 0.12
69 0.12
70 0.11
71 0.13
72 0.15
73 0.17
74 0.18
75 0.22
76 0.24
77 0.28
78 0.33
79 0.37
80 0.41
81 0.43
82 0.46
83 0.47
84 0.48
85 0.47
86 0.46
87 0.43
88 0.4
89 0.36
90 0.34
91 0.3
92 0.29
93 0.3
94 0.28
95 0.27
96 0.27
97 0.27
98 0.23
99 0.22
100 0.21
101 0.16
102 0.17
103 0.15
104 0.16
105 0.17
106 0.22
107 0.21
108 0.22
109 0.2
110 0.16
111 0.17
112 0.14
113 0.14
114 0.1
115 0.1
116 0.09
117 0.09
118 0.13
119 0.17
120 0.19
121 0.18
122 0.2
123 0.29
124 0.37
125 0.44
126 0.5
127 0.5
128 0.55
129 0.64
130 0.71
131 0.71
132 0.73
133 0.73