Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0B7NIW8

Protein Details
Accession A0A0B7NIW8    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
48-72VMSFTKTKKAKEKEEKKSTRNPFELHydrophilic
NLS Segment(s)
PositionSequence
56-62KAKEKEE
Subcellular Location(s) mito 13, cyto 6.5, cyto_nucl 6, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008606  EIF4EBP  
Gene Ontology GO:0008190  F:eukaryotic initiation factor 4E binding  
GO:0045947  P:negative regulation of translational initiation  
Pfam View protein in Pfam  
PF05456  eIF_4EBP  
Amino Acid Sequences MEAKQGNRVTYDRNTLLALAGSSFAKIIPAKMAFVPGVTRTPNQSDVVMSFTKTKKAKEKEEKKSTRNPFELLGDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.28
3 0.26
4 0.21
5 0.16
6 0.09
7 0.09
8 0.07
9 0.07
10 0.07
11 0.06
12 0.07
13 0.08
14 0.08
15 0.1
16 0.11
17 0.12
18 0.12
19 0.13
20 0.11
21 0.11
22 0.11
23 0.09
24 0.1
25 0.11
26 0.11
27 0.12
28 0.14
29 0.17
30 0.17
31 0.16
32 0.15
33 0.14
34 0.17
35 0.16
36 0.14
37 0.17
38 0.17
39 0.24
40 0.26
41 0.31
42 0.37
43 0.45
44 0.55
45 0.61
46 0.71
47 0.75
48 0.83
49 0.87
50 0.84
51 0.87
52 0.86
53 0.85
54 0.78
55 0.69
56 0.62