Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0B7NW75

Protein Details
Accession A0A0B7NW75    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
9-28LKSHKEKQSDIKRHNEQLKKBasic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 10.833, mito_nucl 10.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR009395  BLOC1S1  
Gene Ontology GO:0031083  C:BLOC-1 complex  
GO:0051179  P:localization  
Pfam View protein in Pfam  
PF06320  GCN5L1  
Amino Acid Sequences MSESLSQLLKSHKEKQSDIKRHNEQLKKNAIHATNTLTDSITEYVNEGVTEIFSRQKELEQQSRKLANQTTKYANQTQQWLTLVDNFNMSLKELGDVKNWAEIMEHDMKTVMATLEFVHQGTIDGAGPIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.61
3 0.66
4 0.69
5 0.7
6 0.71
7 0.73
8 0.76
9 0.81
10 0.78
11 0.74
12 0.73
13 0.76
14 0.67
15 0.63
16 0.61
17 0.53
18 0.48
19 0.42
20 0.37
21 0.3
22 0.29
23 0.26
24 0.2
25 0.18
26 0.17
27 0.17
28 0.13
29 0.09
30 0.09
31 0.09
32 0.08
33 0.08
34 0.06
35 0.05
36 0.05
37 0.06
38 0.06
39 0.09
40 0.09
41 0.11
42 0.11
43 0.12
44 0.18
45 0.23
46 0.32
47 0.33
48 0.36
49 0.4
50 0.43
51 0.42
52 0.39
53 0.37
54 0.35
55 0.33
56 0.35
57 0.34
58 0.34
59 0.37
60 0.38
61 0.38
62 0.33
63 0.34
64 0.31
65 0.29
66 0.26
67 0.23
68 0.2
69 0.22
70 0.21
71 0.17
72 0.17
73 0.15
74 0.14
75 0.14
76 0.14
77 0.09
78 0.08
79 0.09
80 0.1
81 0.11
82 0.12
83 0.13
84 0.13
85 0.15
86 0.15
87 0.14
88 0.13
89 0.12
90 0.17
91 0.22
92 0.22
93 0.19
94 0.2
95 0.19
96 0.19
97 0.19
98 0.13
99 0.06
100 0.07
101 0.07
102 0.1
103 0.11
104 0.11
105 0.1
106 0.1
107 0.11
108 0.11
109 0.11
110 0.08