Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0B7NL60

Protein Details
Accession A0A0B7NL60    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
72-91PAPHKPLKYKPNKLEKHERMBasic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, mito_nucl 12.5, mito 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040922  MRPL25_dom  
Pfam View protein in Pfam  
PF18126  Mitoc_mL59  
Amino Acid Sequences MATYRNFSLKFLSKLNNTKLVEADVKSQLVFNEAKGKSFWRPAQISKRTQNDLRKACLQCGIEPASIGLAAPAPHKPLKYKPNKLEKHERMRAERQANIQRNLEKMPQTIQAWKEDKLKELAKQKTSMPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.56
3 0.58
4 0.52
5 0.5
6 0.46
7 0.43
8 0.39
9 0.32
10 0.32
11 0.25
12 0.24
13 0.23
14 0.22
15 0.18
16 0.18
17 0.17
18 0.14
19 0.21
20 0.2
21 0.21
22 0.21
23 0.24
24 0.24
25 0.31
26 0.32
27 0.3
28 0.34
29 0.41
30 0.5
31 0.55
32 0.59
33 0.6
34 0.63
35 0.6
36 0.63
37 0.64
38 0.63
39 0.59
40 0.56
41 0.56
42 0.51
43 0.47
44 0.45
45 0.38
46 0.29
47 0.29
48 0.27
49 0.19
50 0.18
51 0.17
52 0.11
53 0.1
54 0.09
55 0.06
56 0.04
57 0.04
58 0.05
59 0.06
60 0.09
61 0.1
62 0.11
63 0.15
64 0.22
65 0.32
66 0.41
67 0.51
68 0.57
69 0.66
70 0.73
71 0.77
72 0.81
73 0.8
74 0.8
75 0.78
76 0.74
77 0.71
78 0.71
79 0.72
80 0.66
81 0.6
82 0.59
83 0.61
84 0.63
85 0.6
86 0.57
87 0.51
88 0.49
89 0.48
90 0.44
91 0.37
92 0.31
93 0.3
94 0.31
95 0.31
96 0.34
97 0.33
98 0.37
99 0.37
100 0.4
101 0.45
102 0.4
103 0.42
104 0.43
105 0.45
106 0.43
107 0.5
108 0.55
109 0.52
110 0.53