Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9DFD5

Protein Details
Accession E9DFD5    Localization Confidence High Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MVKPLTFKGDKKTKKRKRHDDDPSNPHSRGBasic
239-260LEEHEVKRLRRARREGNYHEEIBasic
NLS Segment(s)
PositionSequence
9-18GDKKTKKRKR
209-252RFKPKLKASKESKALEKISRKELEAAVGRKLEEHEVKRLRRARR
Subcellular Location(s) nucl 16.5, cyto_nucl 12, cyto 6.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR008999  Actin-crosslinking  
IPR010414  FRG1  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF06229  FRG1  
Amino Acid Sequences MVKPLTFKGDKKTKKRKRHDDDPSNPHSRGSQNTSSAIAEATEDHDEQSWVAADVPLDISGPVMFVLPSTPPTCIACDVNGKVFASEIENTVDGDPRTAEPHDVRQVWVATKVAGSDGINFKGHHGRYLSCDKYGLLSATSPAVSAFESFVPVSSPDSPGMFSFQICGGDMEAFLAIKEGKTSSSTVEIRGDADSVSFDTTFRIRMQARFKPKLKASKESKALEKISRKELEAAVGRKLEEHEVKRLRRARREGNYHEEILDVRVKGKHDKFAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.92
3 0.93
4 0.93
5 0.94
6 0.94
7 0.94
8 0.94
9 0.92
10 0.89
11 0.84
12 0.74
13 0.64
14 0.57
15 0.5
16 0.46
17 0.45
18 0.43
19 0.4
20 0.41
21 0.42
22 0.38
23 0.34
24 0.27
25 0.19
26 0.13
27 0.1
28 0.12
29 0.12
30 0.12
31 0.12
32 0.12
33 0.12
34 0.12
35 0.12
36 0.1
37 0.08
38 0.08
39 0.08
40 0.07
41 0.08
42 0.09
43 0.08
44 0.07
45 0.07
46 0.06
47 0.06
48 0.06
49 0.05
50 0.05
51 0.04
52 0.04
53 0.05
54 0.06
55 0.09
56 0.09
57 0.1
58 0.11
59 0.13
60 0.15
61 0.16
62 0.16
63 0.16
64 0.2
65 0.21
66 0.22
67 0.22
68 0.21
69 0.18
70 0.17
71 0.16
72 0.13
73 0.12
74 0.11
75 0.1
76 0.11
77 0.11
78 0.12
79 0.13
80 0.11
81 0.11
82 0.1
83 0.1
84 0.12
85 0.11
86 0.14
87 0.13
88 0.19
89 0.24
90 0.24
91 0.24
92 0.24
93 0.25
94 0.23
95 0.23
96 0.17
97 0.12
98 0.11
99 0.11
100 0.08
101 0.08
102 0.08
103 0.09
104 0.11
105 0.12
106 0.14
107 0.14
108 0.15
109 0.2
110 0.2
111 0.19
112 0.19
113 0.18
114 0.22
115 0.29
116 0.29
117 0.23
118 0.23
119 0.21
120 0.2
121 0.2
122 0.16
123 0.08
124 0.07
125 0.07
126 0.07
127 0.07
128 0.06
129 0.05
130 0.05
131 0.05
132 0.05
133 0.06
134 0.05
135 0.06
136 0.06
137 0.06
138 0.06
139 0.07
140 0.09
141 0.09
142 0.1
143 0.1
144 0.1
145 0.11
146 0.11
147 0.13
148 0.11
149 0.1
150 0.09
151 0.1
152 0.1
153 0.09
154 0.1
155 0.07
156 0.07
157 0.07
158 0.06
159 0.06
160 0.05
161 0.04
162 0.05
163 0.05
164 0.04
165 0.05
166 0.05
167 0.06
168 0.08
169 0.09
170 0.09
171 0.16
172 0.16
173 0.18
174 0.19
175 0.19
176 0.18
177 0.18
178 0.17
179 0.1
180 0.1
181 0.08
182 0.07
183 0.08
184 0.07
185 0.07
186 0.08
187 0.09
188 0.11
189 0.11
190 0.16
191 0.17
192 0.24
193 0.32
194 0.39
195 0.49
196 0.56
197 0.59
198 0.62
199 0.67
200 0.71
201 0.68
202 0.7
203 0.68
204 0.68
205 0.73
206 0.69
207 0.68
208 0.65
209 0.64
210 0.62
211 0.63
212 0.58
213 0.58
214 0.56
215 0.51
216 0.48
217 0.44
218 0.42
219 0.41
220 0.38
221 0.34
222 0.33
223 0.31
224 0.29
225 0.3
226 0.3
227 0.31
228 0.32
229 0.38
230 0.45
231 0.49
232 0.57
233 0.63
234 0.65
235 0.67
236 0.73
237 0.73
238 0.75
239 0.82
240 0.8
241 0.82
242 0.78
243 0.69
244 0.6
245 0.5
246 0.41
247 0.34
248 0.31
249 0.22
250 0.2
251 0.22
252 0.24
253 0.33
254 0.37