Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7NIY3

Protein Details
Accession A0A0B7NIY3    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
192-222NGQKAAKIAKQKARRAKRAKEKYGNPQQKSMHydrophilic
NLS Segment(s)
PositionSequence
188-213KQSKNGQKAAKIAKQKARRAKRAKEK
Subcellular Location(s) cyto_nucl 16, nucl 14.5, cyto 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001623  DnaJ_domain  
IPR007872  DPH_MB_dom  
IPR036671  DPH_MB_sf  
IPR036869  J_dom_sf  
IPR000352  Pep_chain_release_fac_I  
IPR045853  Pep_chain_release_fac_I_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003747  F:translation release factor activity  
Pfam View protein in Pfam  
PF00226  DnaJ  
PF00472  RF-1  
PF05207  zf-CSL  
PROSITE View protein in PROSITE  
PS50076  DNAJ_2  
CDD cd06257  DnaJ  
Amino Acid Sequences MSTYYEILQVSETASPDIIKQRFQQLILKHHPDKSTNNDKNSLTHNILKAWEILRNPTSRKEYDIELQRQRNKKDVAIGAEVDLDDMEYNAAEGSYSLVCRCSGDYVITEDELETGIDVVGYEDLVETFVKGSGPGGQCINKRSSCVDLRHIPTGIRVQCQQSRSLADNRGIARKLLREKLDELINGKQSKNGQKAAKIAKQKARRAKRAKEKYGNPQQKSMGDTTPTATNFLQEQVKEGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.14
4 0.22
5 0.23
6 0.24
7 0.27
8 0.34
9 0.37
10 0.39
11 0.43
12 0.4
13 0.48
14 0.54
15 0.59
16 0.55
17 0.58
18 0.59
19 0.57
20 0.57
21 0.57
22 0.59
23 0.58
24 0.58
25 0.58
26 0.56
27 0.54
28 0.53
29 0.5
30 0.43
31 0.41
32 0.38
33 0.34
34 0.34
35 0.32
36 0.29
37 0.24
38 0.23
39 0.19
40 0.23
41 0.25
42 0.28
43 0.3
44 0.34
45 0.39
46 0.36
47 0.39
48 0.36
49 0.35
50 0.39
51 0.45
52 0.46
53 0.49
54 0.56
55 0.59
56 0.65
57 0.64
58 0.63
59 0.57
60 0.51
61 0.49
62 0.45
63 0.42
64 0.37
65 0.35
66 0.28
67 0.25
68 0.23
69 0.16
70 0.11
71 0.07
72 0.04
73 0.04
74 0.04
75 0.03
76 0.03
77 0.03
78 0.03
79 0.03
80 0.03
81 0.04
82 0.05
83 0.05
84 0.05
85 0.06
86 0.06
87 0.07
88 0.08
89 0.08
90 0.08
91 0.09
92 0.09
93 0.11
94 0.12
95 0.11
96 0.11
97 0.09
98 0.08
99 0.08
100 0.06
101 0.04
102 0.03
103 0.03
104 0.03
105 0.03
106 0.03
107 0.03
108 0.02
109 0.02
110 0.02
111 0.02
112 0.03
113 0.03
114 0.03
115 0.04
116 0.04
117 0.04
118 0.04
119 0.05
120 0.09
121 0.1
122 0.11
123 0.13
124 0.16
125 0.18
126 0.21
127 0.26
128 0.21
129 0.22
130 0.22
131 0.26
132 0.28
133 0.3
134 0.33
135 0.35
136 0.38
137 0.39
138 0.38
139 0.33
140 0.3
141 0.34
142 0.29
143 0.25
144 0.24
145 0.26
146 0.3
147 0.31
148 0.3
149 0.26
150 0.27
151 0.29
152 0.32
153 0.31
154 0.29
155 0.33
156 0.33
157 0.36
158 0.33
159 0.3
160 0.27
161 0.3
162 0.34
163 0.36
164 0.37
165 0.35
166 0.36
167 0.39
168 0.4
169 0.35
170 0.32
171 0.3
172 0.34
173 0.33
174 0.31
175 0.3
176 0.33
177 0.41
178 0.44
179 0.46
180 0.44
181 0.45
182 0.54
183 0.59
184 0.59
185 0.6
186 0.62
187 0.64
188 0.69
189 0.74
190 0.77
191 0.79
192 0.83
193 0.84
194 0.86
195 0.88
196 0.9
197 0.92
198 0.91
199 0.89
200 0.89
201 0.91
202 0.9
203 0.82
204 0.78
205 0.72
206 0.64
207 0.6
208 0.53
209 0.46
210 0.38
211 0.36
212 0.32
213 0.33
214 0.3
215 0.29
216 0.26
217 0.23
218 0.22
219 0.25
220 0.27
221 0.21