Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0B7NDB3

Protein Details
Accession A0A0B7NDB3    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
23-46GAASPKKVIKRVRIQKKPQDIVESHydrophilic
NLS Segment(s)
PositionSequence
14-39EKKAGNRNTGAASPKKVIKRVRIQKK
176-181EKKALK
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR012459  Rrp15  
Gene Ontology GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF07890  Rrp15p  
Amino Acid Sequences MAAKKQVKKQQIVEKKAGNRNTGAASPKKVIKRVRIQKKPQDIVESASSESSADEEEKENEEEDEDEVKEESSAMDIDHDTDSGDDGEADDDNEDEGDDTDDDDEFDGDEMELEAGTKQPKKFSSEAFSDAMTKILASTLTGSDKKQPILARSKGLERKIEDEKLDYKARKIMSAEKKALKEKGRVIPDFTTFEYEKRLRKVATRGVVKLFNAIRVQQKVTEVAVQNAAETRKTFAAVEKAKSVSTMSKSSFLDLLKTGQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.77
3 0.78
4 0.74
5 0.67
6 0.58
7 0.54
8 0.5
9 0.46
10 0.43
11 0.4
12 0.38
13 0.39
14 0.44
15 0.46
16 0.5
17 0.53
18 0.56
19 0.62
20 0.69
21 0.75
22 0.79
23 0.84
24 0.87
25 0.9
26 0.87
27 0.8
28 0.76
29 0.66
30 0.6
31 0.54
32 0.46
33 0.36
34 0.29
35 0.25
36 0.18
37 0.16
38 0.12
39 0.09
40 0.08
41 0.08
42 0.1
43 0.12
44 0.15
45 0.15
46 0.15
47 0.14
48 0.14
49 0.13
50 0.13
51 0.13
52 0.11
53 0.11
54 0.11
55 0.1
56 0.1
57 0.09
58 0.07
59 0.06
60 0.06
61 0.05
62 0.06
63 0.06
64 0.08
65 0.08
66 0.08
67 0.07
68 0.07
69 0.08
70 0.07
71 0.07
72 0.05
73 0.05
74 0.06
75 0.05
76 0.06
77 0.05
78 0.05
79 0.05
80 0.05
81 0.04
82 0.04
83 0.04
84 0.05
85 0.05
86 0.05
87 0.05
88 0.05
89 0.06
90 0.05
91 0.05
92 0.04
93 0.04
94 0.04
95 0.04
96 0.04
97 0.04
98 0.03
99 0.03
100 0.03
101 0.03
102 0.05
103 0.08
104 0.11
105 0.12
106 0.16
107 0.18
108 0.22
109 0.24
110 0.26
111 0.28
112 0.28
113 0.31
114 0.28
115 0.26
116 0.23
117 0.21
118 0.18
119 0.13
120 0.09
121 0.06
122 0.05
123 0.05
124 0.04
125 0.05
126 0.05
127 0.08
128 0.1
129 0.1
130 0.16
131 0.18
132 0.18
133 0.21
134 0.22
135 0.24
136 0.32
137 0.34
138 0.32
139 0.32
140 0.39
141 0.41
142 0.42
143 0.41
144 0.34
145 0.37
146 0.38
147 0.39
148 0.33
149 0.31
150 0.3
151 0.3
152 0.35
153 0.31
154 0.27
155 0.29
156 0.29
157 0.28
158 0.28
159 0.33
160 0.37
161 0.44
162 0.49
163 0.5
164 0.53
165 0.55
166 0.6
167 0.55
168 0.51
169 0.51
170 0.52
171 0.54
172 0.51
173 0.5
174 0.46
175 0.45
176 0.42
177 0.35
178 0.32
179 0.26
180 0.25
181 0.29
182 0.3
183 0.32
184 0.33
185 0.37
186 0.33
187 0.38
188 0.46
189 0.47
190 0.51
191 0.52
192 0.51
193 0.51
194 0.53
195 0.47
196 0.46
197 0.38
198 0.33
199 0.29
200 0.3
201 0.32
202 0.32
203 0.34
204 0.3
205 0.31
206 0.28
207 0.28
208 0.31
209 0.25
210 0.24
211 0.26
212 0.23
213 0.22
214 0.23
215 0.23
216 0.18
217 0.18
218 0.19
219 0.16
220 0.18
221 0.18
222 0.19
223 0.28
224 0.32
225 0.35
226 0.36
227 0.36
228 0.35
229 0.35
230 0.33
231 0.3
232 0.29
233 0.32
234 0.3
235 0.35
236 0.35
237 0.37
238 0.38
239 0.32
240 0.3
241 0.26