Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7N4V9

Protein Details
Accession A0A0B7N4V9    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
3-28TLMPKEKVSKSSKEKKNPNAPKRGLSHydrophilic
NLS Segment(s)
PositionSequence
12-23KSSKEKKNPNAP
Subcellular Location(s) nucl 18, mito_nucl 13.333, cyto_nucl 9.833, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MNTLMPKEKVSKSSKEKKNPNAPKRGLSAYMFFSQDNRAKVKEDNPEASFGTIGKLLGEKWKGLSDQEKKPYLEKAEADKKRYEKEKAAQNE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.74
3 0.8
4 0.82
5 0.88
6 0.89
7 0.88
8 0.88
9 0.82
10 0.77
11 0.71
12 0.64
13 0.56
14 0.47
15 0.4
16 0.33
17 0.31
18 0.28
19 0.23
20 0.21
21 0.22
22 0.25
23 0.24
24 0.23
25 0.21
26 0.22
27 0.24
28 0.29
29 0.31
30 0.31
31 0.32
32 0.31
33 0.32
34 0.3
35 0.28
36 0.23
37 0.15
38 0.12
39 0.08
40 0.07
41 0.06
42 0.06
43 0.06
44 0.11
45 0.12
46 0.11
47 0.12
48 0.15
49 0.15
50 0.17
51 0.26
52 0.28
53 0.36
54 0.43
55 0.47
56 0.46
57 0.48
58 0.51
59 0.46
60 0.45
61 0.4
62 0.42
63 0.47
64 0.52
65 0.54
66 0.55
67 0.56
68 0.59
69 0.63
70 0.61
71 0.59
72 0.61