Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0B7N6E9

Protein Details
Accession A0A0B7N6E9    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
90-118QQPKTMPKKKTPTSPHKEHKRFSFRNFFRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 13.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011992  EF-hand-dom_pair  
IPR018247  EF_Hand_1_Ca_BS  
IPR002048  EF_hand_dom  
Gene Ontology GO:0005509  F:calcium ion binding  
Pfam View protein in Pfam  
PF13499  EF-hand_7  
PROSITE View protein in PROSITE  
PS00018  EF_HAND_1  
PS50222  EF_HAND_2  
CDD cd00051  EFh  
Amino Acid Sequences MDFEEFAKLMRPTLSDPHRLSSKQIELKEAFDVFDKDKDGTINATELRAMMETLGDRLTLEDAKELIKDVDLDKDGTVNFEEFCIMMGVQQPKTMPKKKTPTSPHKEHKRFSFRNFFRSNRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.36
3 0.38
4 0.42
5 0.46
6 0.45
7 0.46
8 0.45
9 0.48
10 0.46
11 0.45
12 0.46
13 0.42
14 0.43
15 0.42
16 0.34
17 0.26
18 0.21
19 0.22
20 0.17
21 0.18
22 0.18
23 0.15
24 0.15
25 0.15
26 0.14
27 0.13
28 0.12
29 0.12
30 0.11
31 0.11
32 0.1
33 0.09
34 0.09
35 0.08
36 0.07
37 0.05
38 0.05
39 0.05
40 0.05
41 0.05
42 0.05
43 0.04
44 0.05
45 0.06
46 0.06
47 0.06
48 0.06
49 0.06
50 0.06
51 0.06
52 0.07
53 0.06
54 0.05
55 0.06
56 0.06
57 0.09
58 0.09
59 0.1
60 0.09
61 0.1
62 0.1
63 0.1
64 0.11
65 0.08
66 0.08
67 0.07
68 0.07
69 0.06
70 0.07
71 0.06
72 0.06
73 0.06
74 0.11
75 0.14
76 0.14
77 0.16
78 0.16
79 0.22
80 0.32
81 0.39
82 0.39
83 0.46
84 0.56
85 0.61
86 0.71
87 0.74
88 0.77
89 0.78
90 0.84
91 0.85
92 0.86
93 0.88
94 0.85
95 0.85
96 0.85
97 0.83
98 0.82
99 0.82
100 0.76
101 0.77
102 0.77