Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7NNM2

Protein Details
Accession A0A0B7NNM2   
Localization Confidence Low
Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
39-59LRDDERRKKKQQQQTLNMRELHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, nucl 8, plas 2, extr 2, E.R. 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR031568  Pet117  
Gene Ontology GO:0005739  C:mitochondrion  
Pfam View protein in Pfam  
PF15786  PET117  
Amino Acid Sequences MSKAAKATLTASIVFCCASVFGVHYFQNEEKENLRAGVLRDDERRKKKQQQQTLNMRELKEQQELHEALLKTQEVTNLPSNEPMSDED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.14
3 0.1
4 0.08
5 0.07
6 0.06
7 0.08
8 0.09
9 0.12
10 0.12
11 0.13
12 0.16
13 0.16
14 0.2
15 0.2
16 0.2
17 0.19
18 0.2
19 0.2
20 0.17
21 0.16
22 0.14
23 0.13
24 0.15
25 0.16
26 0.17
27 0.22
28 0.29
29 0.37
30 0.43
31 0.49
32 0.52
33 0.6
34 0.67
35 0.72
36 0.74
37 0.76
38 0.79
39 0.83
40 0.82
41 0.79
42 0.73
43 0.64
44 0.56
45 0.5
46 0.44
47 0.38
48 0.32
49 0.27
50 0.31
51 0.3
52 0.29
53 0.31
54 0.27
55 0.22
56 0.25
57 0.23
58 0.18
59 0.18
60 0.2
61 0.15
62 0.2
63 0.26
64 0.26
65 0.27
66 0.3
67 0.3
68 0.27