Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7N7N4

Protein Details
Accession A0A0B7N7N4    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
20-43MSRKLAMKKTKSKKATRPVKPVPTHydrophilic
64-84YTPAAFNKTKKSKRARDYEAPHydrophilic
NLS Segment(s)
PositionSequence
22-39RKLAMKKTKSKKATRPVK
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MSNMEYDLDNMRKDLFLKVMSRKLAMKKTKSKKATRPVKPVPTIMTRTKRYISSLKMLNIEAAYTPAAFNKTKKSKRARDYEAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.17
3 0.18
4 0.23
5 0.28
6 0.33
7 0.34
8 0.34
9 0.37
10 0.41
11 0.46
12 0.49
13 0.52
14 0.57
15 0.65
16 0.73
17 0.77
18 0.79
19 0.79
20 0.81
21 0.83
22 0.82
23 0.82
24 0.81
25 0.8
26 0.73
27 0.66
28 0.59
29 0.53
30 0.48
31 0.46
32 0.45
33 0.4
34 0.4
35 0.41
36 0.38
37 0.38
38 0.39
39 0.35
40 0.34
41 0.35
42 0.35
43 0.35
44 0.34
45 0.31
46 0.25
47 0.22
48 0.15
49 0.12
50 0.1
51 0.08
52 0.08
53 0.08
54 0.12
55 0.13
56 0.16
57 0.25
58 0.35
59 0.43
60 0.52
61 0.61
62 0.69
63 0.77
64 0.85