Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0B7NNX7

Protein Details
Accession A0A0B7NNX7    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
123-148AEETKLSAKKKKKTIKSKSKATSLLSHydrophilic
NLS Segment(s)
PositionSequence
127-142KLSAKKKKKTIKSKSK
Subcellular Location(s) nucl 20, cyto_nucl 12, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MPPKKNFTPKQLSNSLSYVQKEAPFLARLKNQSQEKERATRKFENYEDGQDDDDYDELDGAQVVELDSNGREIFKKQEDEEEKEQEKKEADEPEEPAVDENGRLLFRKQKQISSKRKLQSIIAEETKLSAKKKKKTIKSKSKATSLLSFQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.53
3 0.48
4 0.42
5 0.36
6 0.31
7 0.31
8 0.28
9 0.26
10 0.26
11 0.24
12 0.24
13 0.27
14 0.29
15 0.32
16 0.35
17 0.41
18 0.43
19 0.48
20 0.52
21 0.55
22 0.54
23 0.59
24 0.63
25 0.61
26 0.63
27 0.63
28 0.62
29 0.61
30 0.57
31 0.54
32 0.49
33 0.47
34 0.42
35 0.35
36 0.31
37 0.23
38 0.22
39 0.16
40 0.14
41 0.09
42 0.07
43 0.06
44 0.04
45 0.04
46 0.04
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.04
54 0.03
55 0.04
56 0.04
57 0.05
58 0.05
59 0.06
60 0.11
61 0.14
62 0.16
63 0.15
64 0.24
65 0.28
66 0.34
67 0.37
68 0.39
69 0.37
70 0.39
71 0.39
72 0.33
73 0.29
74 0.25
75 0.25
76 0.23
77 0.23
78 0.23
79 0.24
80 0.24
81 0.24
82 0.22
83 0.18
84 0.15
85 0.12
86 0.1
87 0.08
88 0.08
89 0.08
90 0.09
91 0.1
92 0.18
93 0.23
94 0.34
95 0.36
96 0.42
97 0.52
98 0.62
99 0.71
100 0.71
101 0.76
102 0.71
103 0.73
104 0.68
105 0.62
106 0.59
107 0.54
108 0.52
109 0.46
110 0.41
111 0.36
112 0.35
113 0.35
114 0.3
115 0.29
116 0.3
117 0.36
118 0.44
119 0.55
120 0.64
121 0.7
122 0.78
123 0.86
124 0.89
125 0.9
126 0.92
127 0.89
128 0.88
129 0.83
130 0.78
131 0.73