Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9D2X9

Protein Details
Accession E9D2X9    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
234-255KMSDKEKKKSLSHKARKRLFHABasic
NLS Segment(s)
PositionSequence
238-266KEKKKSLSHKARKRLFHARVREKAVEEKV
Subcellular Location(s) nucl 12.5, mito_nucl 12.333, mito 11, cyto_mito 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR024629  Mhr1  
Gene Ontology GO:0000150  F:DNA strand exchange activity  
GO:0003697  F:single-stranded DNA binding  
GO:0000002  P:mitochondrial genome maintenance  
Pfam View protein in Pfam  
PF12829  Mhr1  
Amino Acid Sequences MATTAAAAATKAPKTIQLLDPTTLATSRAVRYPPSNGKPIQGKVRFPNSKAAKHYREQESIRLRKALQHVTHGKNIFAYNNLRTNQVIYSLSRTLERQNVLSQLIYHGKKTVPATLRKDMWIPYFSLHFPSSSLGLSAYKMLREFAVQRQLAPEEESITNTEETLSRKRPRDPLEAKKWDEIWKPRIGQIMMKKDRARVLMDQKATSVADVATVLAMQEQKIKELEEEGKVYEKMSDKEKKKSLSHKARKRLFHARVREKAVEEKVRERIATLERALSKKGIQAKIDEGDELVDHKVADGEVKILWTDLQDAQFAENWPESVRHGELEPVREHIMGSKLKAGDVEAVAEIQSTAAESGATAESQPTEQGKTEEPAKKGLSRLKFWS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.31
3 0.34
4 0.37
5 0.4
6 0.4
7 0.4
8 0.37
9 0.33
10 0.28
11 0.23
12 0.17
13 0.18
14 0.18
15 0.23
16 0.24
17 0.26
18 0.29
19 0.38
20 0.45
21 0.47
22 0.52
23 0.49
24 0.54
25 0.57
26 0.6
27 0.61
28 0.57
29 0.58
30 0.59
31 0.69
32 0.68
33 0.62
34 0.67
35 0.64
36 0.65
37 0.67
38 0.68
39 0.64
40 0.64
41 0.71
42 0.68
43 0.69
44 0.65
45 0.65
46 0.66
47 0.67
48 0.64
49 0.59
50 0.52
51 0.51
52 0.55
53 0.55
54 0.47
55 0.5
56 0.55
57 0.56
58 0.62
59 0.56
60 0.49
61 0.43
62 0.41
63 0.33
64 0.28
65 0.28
66 0.26
67 0.32
68 0.32
69 0.31
70 0.3
71 0.3
72 0.26
73 0.25
74 0.22
75 0.17
76 0.21
77 0.21
78 0.21
79 0.21
80 0.22
81 0.22
82 0.26
83 0.26
84 0.23
85 0.24
86 0.26
87 0.26
88 0.25
89 0.21
90 0.19
91 0.25
92 0.24
93 0.22
94 0.22
95 0.21
96 0.25
97 0.26
98 0.3
99 0.29
100 0.36
101 0.42
102 0.46
103 0.48
104 0.45
105 0.46
106 0.41
107 0.38
108 0.31
109 0.25
110 0.2
111 0.21
112 0.2
113 0.21
114 0.19
115 0.15
116 0.15
117 0.15
118 0.15
119 0.12
120 0.12
121 0.09
122 0.09
123 0.09
124 0.12
125 0.11
126 0.11
127 0.11
128 0.11
129 0.1
130 0.12
131 0.14
132 0.16
133 0.24
134 0.23
135 0.23
136 0.25
137 0.25
138 0.24
139 0.23
140 0.18
141 0.13
142 0.13
143 0.14
144 0.13
145 0.14
146 0.13
147 0.11
148 0.11
149 0.1
150 0.13
151 0.18
152 0.24
153 0.29
154 0.33
155 0.37
156 0.45
157 0.49
158 0.56
159 0.59
160 0.62
161 0.66
162 0.71
163 0.68
164 0.63
165 0.59
166 0.54
167 0.51
168 0.47
169 0.42
170 0.39
171 0.38
172 0.38
173 0.39
174 0.35
175 0.33
176 0.34
177 0.4
178 0.39
179 0.43
180 0.41
181 0.4
182 0.42
183 0.39
184 0.35
185 0.3
186 0.34
187 0.35
188 0.36
189 0.33
190 0.3
191 0.3
192 0.26
193 0.2
194 0.13
195 0.07
196 0.06
197 0.06
198 0.05
199 0.04
200 0.04
201 0.04
202 0.04
203 0.05
204 0.04
205 0.09
206 0.09
207 0.1
208 0.11
209 0.12
210 0.11
211 0.14
212 0.16
213 0.14
214 0.15
215 0.15
216 0.16
217 0.16
218 0.16
219 0.16
220 0.16
221 0.16
222 0.23
223 0.31
224 0.33
225 0.42
226 0.47
227 0.5
228 0.54
229 0.62
230 0.65
231 0.68
232 0.75
233 0.76
234 0.81
235 0.82
236 0.81
237 0.79
238 0.79
239 0.76
240 0.74
241 0.75
242 0.75
243 0.73
244 0.74
245 0.69
246 0.61
247 0.58
248 0.57
249 0.53
250 0.47
251 0.45
252 0.44
253 0.43
254 0.41
255 0.35
256 0.32
257 0.29
258 0.3
259 0.26
260 0.26
261 0.28
262 0.29
263 0.3
264 0.27
265 0.24
266 0.24
267 0.31
268 0.31
269 0.28
270 0.29
271 0.32
272 0.34
273 0.33
274 0.29
275 0.2
276 0.16
277 0.15
278 0.14
279 0.11
280 0.08
281 0.07
282 0.07
283 0.08
284 0.07
285 0.08
286 0.07
287 0.07
288 0.07
289 0.08
290 0.08
291 0.07
292 0.08
293 0.07
294 0.1
295 0.11
296 0.12
297 0.13
298 0.13
299 0.14
300 0.17
301 0.17
302 0.17
303 0.15
304 0.14
305 0.14
306 0.15
307 0.15
308 0.17
309 0.17
310 0.16
311 0.16
312 0.21
313 0.23
314 0.28
315 0.27
316 0.26
317 0.27
318 0.26
319 0.25
320 0.23
321 0.26
322 0.24
323 0.24
324 0.27
325 0.26
326 0.26
327 0.26
328 0.24
329 0.21
330 0.19
331 0.19
332 0.13
333 0.13
334 0.13
335 0.12
336 0.11
337 0.07
338 0.06
339 0.05
340 0.05
341 0.05
342 0.05
343 0.04
344 0.07
345 0.08
346 0.08
347 0.08
348 0.09
349 0.1
350 0.11
351 0.14
352 0.14
353 0.16
354 0.17
355 0.2
356 0.23
357 0.26
358 0.35
359 0.38
360 0.38
361 0.42
362 0.45
363 0.46
364 0.5
365 0.54
366 0.53