Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7MQI3

Protein Details
Accession A0A0B7MQI3   
Localization Confidence Low
Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MDTLARKESKKKRDEYYDRAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto_nucl 12, cyto 9, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038279  Ndc10_dom2_sf  
IPR031872  NDC10_II  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF16787  NDC10_II  
Amino Acid Sequences MDTLARKESKKKRDEYYDRAALTIGDGYTTVEELTALVAHYIKQNSEEGLRNALICLLSHYMYLRGASARQAELADLQSLHFTAEGPTPCPALLFLMTESKSNKHGPRRGFSGHDDLKGLVRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.8
3 0.79
4 0.77
5 0.68
6 0.61
7 0.51
8 0.4
9 0.31
10 0.25
11 0.15
12 0.08
13 0.07
14 0.08
15 0.08
16 0.08
17 0.07
18 0.05
19 0.05
20 0.04
21 0.05
22 0.04
23 0.04
24 0.04
25 0.05
26 0.05
27 0.09
28 0.09
29 0.09
30 0.1
31 0.11
32 0.12
33 0.15
34 0.17
35 0.15
36 0.17
37 0.17
38 0.15
39 0.15
40 0.14
41 0.11
42 0.08
43 0.09
44 0.07
45 0.08
46 0.08
47 0.08
48 0.08
49 0.08
50 0.08
51 0.07
52 0.06
53 0.06
54 0.08
55 0.09
56 0.09
57 0.09
58 0.09
59 0.09
60 0.09
61 0.1
62 0.09
63 0.07
64 0.07
65 0.07
66 0.07
67 0.07
68 0.06
69 0.05
70 0.06
71 0.1
72 0.11
73 0.12
74 0.13
75 0.14
76 0.13
77 0.13
78 0.12
79 0.1
80 0.1
81 0.09
82 0.1
83 0.14
84 0.15
85 0.18
86 0.19
87 0.2
88 0.23
89 0.29
90 0.35
91 0.4
92 0.46
93 0.51
94 0.56
95 0.61
96 0.62
97 0.6
98 0.58
99 0.58
100 0.56
101 0.5
102 0.45
103 0.4