Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7NCH9

Protein Details
Accession A0A0B7NCH9   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
23-100EESKRDRSHSRSLSPRNRRERSSPRRNERRRSRSPRPSRYNRSRSPPRHRRDRSPDYDRKKSSKHRSRSRSRSPARSSBasic
NLS Segment(s)
PositionSequence
11-117KSESKKESRNDKEESKRDRSHSRSLSPRNRRERSSPRRNERRRSRSPRPSRYNRSRSPPRHRRDRSPDYDRKKSSKHRSRSRSRSPARSSPATKSSEQKGVKKVLKK
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039732  Hub1/Ubl5  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:0036211  P:protein modification process  
PROSITE View protein in PROSITE  
PS50053  UBIQUITIN_2  
CDD cd01791  Ubl_UBL5  
Amino Acid Sequences MLKFKKHDTEKSESKKESRNDKEESKRDRSHSRSLSPRNRRERSSPRRNERRRSRSPRPSRYNRSRSPPRHRRDRSPDYDRKKSSKHRSRSRSRSPARSSPATKSSEQKGVKKVLKKQSAYRLIEIEVNDRLGKKVRVKCAPNDLVGDFKKLVAAQIGTDPKKIVLKKWYGEFKDHVTLADYELHDGMNLELYYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.72
3 0.73
4 0.74
5 0.73
6 0.71
7 0.69
8 0.73
9 0.77
10 0.78
11 0.79
12 0.77
13 0.74
14 0.74
15 0.77
16 0.73
17 0.73
18 0.71
19 0.7
20 0.71
21 0.75
22 0.79
23 0.8
24 0.84
25 0.84
26 0.82
27 0.79
28 0.79
29 0.8
30 0.8
31 0.8
32 0.81
33 0.82
34 0.87
35 0.91
36 0.92
37 0.92
38 0.91
39 0.91
40 0.91
41 0.9
42 0.9
43 0.92
44 0.92
45 0.91
46 0.91
47 0.91
48 0.92
49 0.91
50 0.86
51 0.85
52 0.85
53 0.85
54 0.86
55 0.85
56 0.83
57 0.84
58 0.83
59 0.84
60 0.83
61 0.83
62 0.8
63 0.8
64 0.82
65 0.79
66 0.82
67 0.76
68 0.71
69 0.69
70 0.7
71 0.71
72 0.71
73 0.73
74 0.74
75 0.8
76 0.85
77 0.88
78 0.88
79 0.87
80 0.84
81 0.83
82 0.79
83 0.77
84 0.71
85 0.67
86 0.6
87 0.53
88 0.53
89 0.47
90 0.42
91 0.38
92 0.36
93 0.39
94 0.4
95 0.4
96 0.39
97 0.44
98 0.47
99 0.49
100 0.54
101 0.55
102 0.6
103 0.58
104 0.6
105 0.62
106 0.66
107 0.63
108 0.56
109 0.48
110 0.41
111 0.41
112 0.34
113 0.27
114 0.18
115 0.16
116 0.15
117 0.14
118 0.15
119 0.16
120 0.2
121 0.26
122 0.32
123 0.39
124 0.47
125 0.5
126 0.54
127 0.61
128 0.59
129 0.53
130 0.49
131 0.41
132 0.39
133 0.36
134 0.34
135 0.24
136 0.21
137 0.2
138 0.17
139 0.17
140 0.13
141 0.13
142 0.1
143 0.17
144 0.24
145 0.24
146 0.25
147 0.25
148 0.25
149 0.31
150 0.31
151 0.3
152 0.32
153 0.38
154 0.43
155 0.5
156 0.58
157 0.55
158 0.59
159 0.56
160 0.53
161 0.52
162 0.47
163 0.4
164 0.33
165 0.31
166 0.27
167 0.29
168 0.24
169 0.19
170 0.19
171 0.18
172 0.15
173 0.15
174 0.14
175 0.12