Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0B7N6C2

Protein Details
Accession A0A0B7N6C2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
11-38IPKTRNTFCKGSKCRKHTPHKVTQYKAGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, cyto 6.5, cyto_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MCHALWHKVNIPKTRNTFCKGSKCRKHTPHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKIVLRLECTACKYKMQLAIKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.65
3 0.63
4 0.63
5 0.62
6 0.68
7 0.69
8 0.72
9 0.74
10 0.75
11 0.81
12 0.83
13 0.87
14 0.86
15 0.86
16 0.86
17 0.87
18 0.88
19 0.8
20 0.8
21 0.77
22 0.7
23 0.63
24 0.55
25 0.44
26 0.37
27 0.36
28 0.35
29 0.3
30 0.28
31 0.33
32 0.36
33 0.41
34 0.45
35 0.5
36 0.46
37 0.53
38 0.6
39 0.57
40 0.59
41 0.57
42 0.56
43 0.55
44 0.57
45 0.48
46 0.43
47 0.4
48 0.33
49 0.35
50 0.37
51 0.36
52 0.31
53 0.38
54 0.42
55 0.51
56 0.59
57 0.62
58 0.62
59 0.65
60 0.72
61 0.73
62 0.71
63 0.68
64 0.63
65 0.6
66 0.59
67 0.53
68 0.49
69 0.46
70 0.4
71 0.34
72 0.32
73 0.31
74 0.35
75 0.41
76 0.43
77 0.46
78 0.56
79 0.63
80 0.68
81 0.66
82 0.6
83 0.55
84 0.51
85 0.49
86 0.49
87 0.5
88 0.51
89 0.54
90 0.52
91 0.49
92 0.49
93 0.42