Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7NT10

Protein Details
Accession A0A0B7NT10    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
112-144LTSVLRKRRLKMNKHKHKKLRKRTRALRKKLGKBasic
NLS Segment(s)
PositionSequence
117-144RKRRLKMNKHKHKKLRKRTRALRKKLGK
Subcellular Location(s) mito 16.5, mito_nucl 13.666, nucl 9.5, cyto_nucl 6.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR013177  COX24_C  
Pfam View protein in Pfam  
PF08213  COX24_C  
Amino Acid Sequences MLTKELMARFLTTARSRVNGNVWKRSASTTTLTTSINNTIPLFDRALLHNCKYTENRLMLSINTSTLAKNITSVASVSEHVSRLRPFSVPAPPQPSINQPTSSSKVVEELELTSVLRKRRLKMNKHKHKKLRKRTRALRKKLGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.27
4 0.29
5 0.36
6 0.38
7 0.42
8 0.46
9 0.46
10 0.46
11 0.46
12 0.45
13 0.39
14 0.34
15 0.32
16 0.25
17 0.26
18 0.26
19 0.26
20 0.23
21 0.23
22 0.22
23 0.2
24 0.19
25 0.16
26 0.15
27 0.17
28 0.18
29 0.17
30 0.14
31 0.14
32 0.15
33 0.21
34 0.23
35 0.22
36 0.24
37 0.24
38 0.26
39 0.27
40 0.29
41 0.29
42 0.28
43 0.27
44 0.25
45 0.25
46 0.21
47 0.21
48 0.17
49 0.12
50 0.11
51 0.1
52 0.08
53 0.08
54 0.09
55 0.07
56 0.07
57 0.07
58 0.07
59 0.06
60 0.06
61 0.07
62 0.07
63 0.07
64 0.08
65 0.09
66 0.09
67 0.1
68 0.12
69 0.12
70 0.13
71 0.13
72 0.12
73 0.13
74 0.15
75 0.23
76 0.24
77 0.28
78 0.32
79 0.32
80 0.33
81 0.33
82 0.36
83 0.33
84 0.32
85 0.3
86 0.26
87 0.32
88 0.34
89 0.34
90 0.29
91 0.25
92 0.25
93 0.23
94 0.21
95 0.16
96 0.13
97 0.13
98 0.12
99 0.12
100 0.13
101 0.16
102 0.18
103 0.26
104 0.29
105 0.32
106 0.42
107 0.52
108 0.59
109 0.67
110 0.76
111 0.79
112 0.86
113 0.93
114 0.94
115 0.95
116 0.95
117 0.95
118 0.95
119 0.95
120 0.95
121 0.95
122 0.96
123 0.96
124 0.95