Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7NT69

Protein Details
Accession A0A0B7NT69   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
29-64VDKVQKPKSSIKLKDKKRKRKSKSKSHKNQKTGMNEBasic
NLS Segment(s)
PositionSequence
34-57KPKSSIKLKDKKRKRKSKSKSHKN
Subcellular Location(s) nucl 13.5, mito_nucl 12.666, mito 10.5, cyto_nucl 8.833
Family & Domain DBs
Amino Acid Sequences MTKNNEITATTTPSLKIRLKLNTIHAGHVDKVQKPKSSIKLKDKKRKRKSKSKSHKNQKTGMNEKSITASPSSTSPNRLVYWTSERIESTKLILRTVIMAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.31
4 0.31
5 0.36
6 0.39
7 0.43
8 0.47
9 0.49
10 0.47
11 0.44
12 0.4
13 0.36
14 0.33
15 0.34
16 0.32
17 0.26
18 0.33
19 0.36
20 0.36
21 0.38
22 0.44
23 0.48
24 0.53
25 0.59
26 0.62
27 0.67
28 0.75
29 0.81
30 0.85
31 0.87
32 0.88
33 0.9
34 0.89
35 0.91
36 0.91
37 0.91
38 0.92
39 0.92
40 0.92
41 0.93
42 0.93
43 0.88
44 0.85
45 0.81
46 0.79
47 0.76
48 0.68
49 0.62
50 0.53
51 0.47
52 0.42
53 0.36
54 0.27
55 0.2
56 0.17
57 0.12
58 0.14
59 0.19
60 0.17
61 0.2
62 0.22
63 0.25
64 0.25
65 0.26
66 0.25
67 0.26
68 0.31
69 0.33
70 0.32
71 0.3
72 0.3
73 0.31
74 0.31
75 0.27
76 0.24
77 0.25
78 0.24
79 0.23
80 0.23
81 0.21