Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0B7N2T5

Protein Details
Accession A0A0B7N2T5    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
142-182IHVVVKKPPPRKEKAHNKKAAVVNKKRRKLDKGKERASVRLBasic
NLS Segment(s)
PositionSequence
147-179KKPPPRKEKAHNKKAAVVNKKRRKLDKGKERAS
Subcellular Location(s) nucl 25
Family & Domain DBs
Amino Acid Sequences MDCTNYRPLMGYYPKIEHEEYIQKLLDEDPQLYADDIIESLTIQSMDFIISKPQLTHHLKDNMLISVKKPSFEPEARNSEKTLQTRYELFMKWKDSDLDYTKNCIFIDEARSAVGTPARVETPKTRVPSHTIIGAIHSSSVIHVVVKKPPPRKEKAHNKKAAVVNKKRRKLDKGKERASVRLLWKNPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.41
3 0.4
4 0.33
5 0.33
6 0.36
7 0.34
8 0.35
9 0.32
10 0.28
11 0.28
12 0.28
13 0.27
14 0.2
15 0.18
16 0.16
17 0.16
18 0.17
19 0.16
20 0.15
21 0.11
22 0.09
23 0.08
24 0.07
25 0.06
26 0.05
27 0.05
28 0.05
29 0.05
30 0.05
31 0.05
32 0.05
33 0.06
34 0.06
35 0.06
36 0.09
37 0.1
38 0.11
39 0.11
40 0.12
41 0.21
42 0.26
43 0.27
44 0.32
45 0.37
46 0.37
47 0.39
48 0.38
49 0.31
50 0.29
51 0.27
52 0.21
53 0.24
54 0.24
55 0.22
56 0.21
57 0.22
58 0.26
59 0.29
60 0.33
61 0.3
62 0.39
63 0.42
64 0.43
65 0.41
66 0.39
67 0.41
68 0.38
69 0.35
70 0.28
71 0.26
72 0.26
73 0.26
74 0.26
75 0.21
76 0.22
77 0.22
78 0.23
79 0.22
80 0.22
81 0.22
82 0.19
83 0.22
84 0.23
85 0.24
86 0.22
87 0.25
88 0.24
89 0.25
90 0.23
91 0.19
92 0.16
93 0.13
94 0.16
95 0.14
96 0.14
97 0.12
98 0.12
99 0.12
100 0.12
101 0.11
102 0.08
103 0.07
104 0.08
105 0.1
106 0.1
107 0.13
108 0.16
109 0.21
110 0.26
111 0.29
112 0.3
113 0.31
114 0.36
115 0.38
116 0.35
117 0.32
118 0.27
119 0.24
120 0.23
121 0.22
122 0.16
123 0.11
124 0.1
125 0.08
126 0.07
127 0.08
128 0.06
129 0.06
130 0.09
131 0.11
132 0.18
133 0.25
134 0.33
135 0.4
136 0.49
137 0.56
138 0.61
139 0.68
140 0.72
141 0.76
142 0.81
143 0.83
144 0.83
145 0.79
146 0.8
147 0.79
148 0.78
149 0.77
150 0.76
151 0.77
152 0.78
153 0.83
154 0.83
155 0.84
156 0.85
157 0.85
158 0.86
159 0.86
160 0.86
161 0.86
162 0.86
163 0.81
164 0.77
165 0.7
166 0.66
167 0.63
168 0.62