Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7N1G3

Protein Details
Accession A0A0B7N1G3   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
178-201ANNAFPKSKKNTRVKDKKTGKTYDHydrophilic
219-248EIRKTKIVDNKRSEPNKRKKVNCYNCDEPDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MEKQFNTFAQFKAELLAKHTKKVDLNKVVSDIINFKMKKKERISDYITRFEAKRSTYQTEVTKRKLAIQTSINSKEKASASTATELYENEDTIKLIITETVIYQRFCVGYMTTYQTGFLKYFLKGITDKNIKRFAKTNKGSNLQGLYTVLRDIFDDSDSETDSDASNNDSVTDSEEEANNAFPKSKKNTRVKDKKTGKTYDMDDLSAQFKDMVLMVVEEIRKTKIVDNKRSEPNKRKKVNCYNCDEPDHMAQYCKSLASYAIAQIMSTINVLNINPAERYLHLQIHRPTNRNPC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.27
3 0.37
4 0.32
5 0.38
6 0.4
7 0.42
8 0.45
9 0.53
10 0.58
11 0.57
12 0.6
13 0.57
14 0.57
15 0.53
16 0.47
17 0.4
18 0.32
19 0.25
20 0.29
21 0.27
22 0.28
23 0.37
24 0.42
25 0.5
26 0.55
27 0.61
28 0.6
29 0.68
30 0.71
31 0.71
32 0.71
33 0.68
34 0.62
35 0.56
36 0.5
37 0.44
38 0.42
39 0.35
40 0.37
41 0.36
42 0.39
43 0.38
44 0.43
45 0.49
46 0.54
47 0.58
48 0.55
49 0.55
50 0.5
51 0.55
52 0.55
53 0.48
54 0.44
55 0.43
56 0.43
57 0.46
58 0.53
59 0.48
60 0.44
61 0.41
62 0.4
63 0.36
64 0.32
65 0.27
66 0.22
67 0.22
68 0.24
69 0.25
70 0.2
71 0.2
72 0.18
73 0.18
74 0.16
75 0.14
76 0.11
77 0.11
78 0.11
79 0.1
80 0.1
81 0.07
82 0.06
83 0.06
84 0.05
85 0.06
86 0.06
87 0.11
88 0.12
89 0.12
90 0.12
91 0.13
92 0.13
93 0.13
94 0.14
95 0.09
96 0.08
97 0.11
98 0.14
99 0.14
100 0.14
101 0.14
102 0.14
103 0.15
104 0.14
105 0.13
106 0.11
107 0.1
108 0.13
109 0.12
110 0.14
111 0.14
112 0.15
113 0.22
114 0.29
115 0.3
116 0.34
117 0.43
118 0.41
119 0.42
120 0.48
121 0.47
122 0.49
123 0.51
124 0.53
125 0.5
126 0.54
127 0.52
128 0.47
129 0.41
130 0.3
131 0.27
132 0.2
133 0.14
134 0.1
135 0.1
136 0.07
137 0.06
138 0.06
139 0.07
140 0.06
141 0.06
142 0.06
143 0.07
144 0.07
145 0.08
146 0.08
147 0.07
148 0.07
149 0.06
150 0.06
151 0.06
152 0.07
153 0.07
154 0.06
155 0.07
156 0.07
157 0.07
158 0.09
159 0.1
160 0.1
161 0.1
162 0.11
163 0.1
164 0.1
165 0.11
166 0.1
167 0.09
168 0.1
169 0.1
170 0.16
171 0.24
172 0.32
173 0.4
174 0.5
175 0.59
176 0.69
177 0.79
178 0.8
179 0.84
180 0.86
181 0.84
182 0.83
183 0.78
184 0.7
185 0.64
186 0.59
187 0.55
188 0.46
189 0.39
190 0.31
191 0.27
192 0.26
193 0.2
194 0.18
195 0.1
196 0.09
197 0.08
198 0.08
199 0.07
200 0.05
201 0.06
202 0.06
203 0.08
204 0.09
205 0.09
206 0.1
207 0.1
208 0.11
209 0.13
210 0.18
211 0.24
212 0.33
213 0.43
214 0.5
215 0.57
216 0.66
217 0.74
218 0.79
219 0.81
220 0.82
221 0.83
222 0.84
223 0.84
224 0.85
225 0.88
226 0.89
227 0.86
228 0.84
229 0.81
230 0.77
231 0.74
232 0.65
233 0.57
234 0.51
235 0.47
236 0.39
237 0.33
238 0.28
239 0.26
240 0.25
241 0.21
242 0.16
243 0.13
244 0.13
245 0.14
246 0.15
247 0.14
248 0.17
249 0.16
250 0.16
251 0.16
252 0.16
253 0.13
254 0.12
255 0.1
256 0.07
257 0.09
258 0.09
259 0.11
260 0.12
261 0.13
262 0.13
263 0.14
264 0.15
265 0.15
266 0.22
267 0.23
268 0.29
269 0.3
270 0.38
271 0.44
272 0.52
273 0.59
274 0.58