Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7NDL8

Protein Details
Accession A0A0B7NDL8   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
10-35SMLDLHKTRRNTKRQQHRHKSIDENVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007218  DNA_pol_delta_4  
Gene Ontology GO:0006260  P:DNA replication  
GO:0000731  P:DNA synthesis involved in DNA repair  
Pfam View protein in Pfam  
PF04081  DNA_pol_delta_4  
Amino Acid Sequences MPPKKRQSQSMLDLHKTRRNTKRQQHRHKSIDENVIQIGRLQAKQQETNLQDVTKKLESNEFTFHQEHLDETDKLLRAFDLNYDFGPCVGIKRLDRWERAQKLGLNPPANVKDILMKDKTQKYAESVFHQFRMI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.64
3 0.61
4 0.62
5 0.63
6 0.66
7 0.7
8 0.74
9 0.8
10 0.85
11 0.91
12 0.92
13 0.93
14 0.9
15 0.86
16 0.84
17 0.8
18 0.78
19 0.68
20 0.58
21 0.49
22 0.42
23 0.34
24 0.26
25 0.22
26 0.15
27 0.14
28 0.14
29 0.17
30 0.2
31 0.22
32 0.23
33 0.28
34 0.26
35 0.3
36 0.3
37 0.26
38 0.24
39 0.22
40 0.26
41 0.2
42 0.19
43 0.16
44 0.2
45 0.21
46 0.22
47 0.26
48 0.22
49 0.24
50 0.25
51 0.24
52 0.2
53 0.18
54 0.15
55 0.14
56 0.16
57 0.12
58 0.12
59 0.15
60 0.15
61 0.15
62 0.15
63 0.12
64 0.09
65 0.09
66 0.11
67 0.1
68 0.1
69 0.11
70 0.12
71 0.12
72 0.11
73 0.12
74 0.1
75 0.08
76 0.1
77 0.14
78 0.14
79 0.19
80 0.28
81 0.32
82 0.36
83 0.42
84 0.5
85 0.51
86 0.54
87 0.54
88 0.5
89 0.5
90 0.55
91 0.55
92 0.47
93 0.43
94 0.45
95 0.43
96 0.41
97 0.35
98 0.27
99 0.26
100 0.27
101 0.32
102 0.29
103 0.3
104 0.36
105 0.42
106 0.47
107 0.43
108 0.42
109 0.41
110 0.46
111 0.47
112 0.45
113 0.47
114 0.46