Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0B7NMA2

Protein Details
Accession A0A0B7NMA2    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
69-94KRIKADGSRKRKQRQPRKPASKGTITBasic
NLS Segment(s)
PositionSequence
67-90KPKRIKADGSRKRKQRQPRKPASK
Subcellular Location(s) nucl 17.5, cyto_nucl 12.833, cyto 7, cyto_mito 5.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MDYLSNCVFVDESAFDINNMRPSTARYAKGTPAIVTTPSTRAVSHTILGAISAMDVVNIEIRLSDSKPKRIKADGSRKRKQRQPRKPASKGTITGHHMFFLQNSMNFMDQFPEIKGFYIVMDQCPNTHC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.14
4 0.16
5 0.2
6 0.2
7 0.18
8 0.17
9 0.21
10 0.29
11 0.34
12 0.35
13 0.33
14 0.36
15 0.39
16 0.43
17 0.4
18 0.32
19 0.28
20 0.25
21 0.22
22 0.21
23 0.19
24 0.16
25 0.17
26 0.18
27 0.16
28 0.17
29 0.19
30 0.18
31 0.17
32 0.16
33 0.13
34 0.12
35 0.12
36 0.1
37 0.06
38 0.04
39 0.04
40 0.03
41 0.03
42 0.03
43 0.03
44 0.04
45 0.04
46 0.04
47 0.03
48 0.04
49 0.06
50 0.07
51 0.14
52 0.16
53 0.25
54 0.3
55 0.32
56 0.35
57 0.37
58 0.44
59 0.47
60 0.56
61 0.58
62 0.63
63 0.68
64 0.74
65 0.78
66 0.78
67 0.79
68 0.79
69 0.8
70 0.82
71 0.85
72 0.87
73 0.87
74 0.89
75 0.84
76 0.79
77 0.73
78 0.65
79 0.61
80 0.56
81 0.51
82 0.43
83 0.37
84 0.31
85 0.26
86 0.22
87 0.18
88 0.16
89 0.13
90 0.14
91 0.15
92 0.16
93 0.16
94 0.16
95 0.15
96 0.13
97 0.14
98 0.13
99 0.15
100 0.14
101 0.14
102 0.15
103 0.13
104 0.13
105 0.17
106 0.17
107 0.18
108 0.22
109 0.21