Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7NE60

Protein Details
Accession A0A0B7NE60    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
53-74DEENSPRRVKRNKGGRGRGRANBasic
NLS Segment(s)
PositionSequence
61-77PRRVKRNKGGRGRGRAN
Subcellular Location(s) nucl 20, cyto_nucl 15.5, cyto 5
Family & Domain DBs
Amino Acid Sequences MQVQQFQSXXXFGDEESVMIPQVSINEIVHSDESSPPSEDTTAAVINSGSKRHADDEENSPRRVKRNKGGRGRGRAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.1
3 0.09
4 0.08
5 0.06
6 0.06
7 0.07
8 0.07
9 0.07
10 0.08
11 0.08
12 0.09
13 0.1
14 0.09
15 0.09
16 0.1
17 0.11
18 0.12
19 0.13
20 0.12
21 0.12
22 0.12
23 0.11
24 0.1
25 0.1
26 0.09
27 0.07
28 0.07
29 0.07
30 0.09
31 0.1
32 0.1
33 0.09
34 0.1
35 0.11
36 0.14
37 0.17
38 0.18
39 0.21
40 0.29
41 0.39
42 0.42
43 0.42
44 0.44
45 0.43
46 0.49
47 0.53
48 0.53
49 0.53
50 0.59
51 0.68
52 0.76
53 0.84
54 0.85