Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7NRL3

Protein Details
Accession A0A0B7NRL3   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
57-83LQSVQSPKQKVKRKPNPKKVGYHTLPEHydrophilic
NLS Segment(s)
PositionSequence
65-75QKVKRKPNPKK
Subcellular Location(s) nucl 14.5, cyto_nucl 8.5, mito 8, plas 2
Family & Domain DBs
Amino Acid Sequences MQVFAGSISNSSNSNGTRSNAAIAAAIFTPPTPDPGARHLSCSSCLGAYRTPAHCFLQSVQSPKQKVKRKPNPKKVGYHTLPETKNQLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.19
3 0.2
4 0.21
5 0.21
6 0.21
7 0.18
8 0.17
9 0.15
10 0.12
11 0.12
12 0.09
13 0.08
14 0.07
15 0.06
16 0.08
17 0.07
18 0.1
19 0.1
20 0.11
21 0.13
22 0.17
23 0.25
24 0.23
25 0.26
26 0.25
27 0.25
28 0.25
29 0.25
30 0.21
31 0.14
32 0.14
33 0.12
34 0.12
35 0.13
36 0.17
37 0.17
38 0.19
39 0.21
40 0.22
41 0.21
42 0.22
43 0.2
44 0.24
45 0.25
46 0.28
47 0.32
48 0.37
49 0.39
50 0.44
51 0.52
52 0.54
53 0.61
54 0.67
55 0.72
56 0.78
57 0.86
58 0.91
59 0.93
60 0.91
61 0.91
62 0.88
63 0.87
64 0.8
65 0.76
66 0.72
67 0.71
68 0.64
69 0.59