Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7NX74

Protein Details
Accession A0A0B7NX74   
Localization Confidence High
Confidence Score 18.3
NoLS Segment(s)
PositionSequenceProtein Nature
49-72KMKTAYFTKHPKRKRGPGLKINLEHydrophilic
93-116EEYIKASRRRARKRLENENATKENHydrophilic
NLS Segment(s)
PositionSequence
57-65KHPKRKRGP
100-106RRRARKR
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MSDLSNDTYISDQKTPSLAAFVLDHQRLVSTYIGQFDKITDAKVNLNRKMKTAYFTKHPKRKRGPGLKINLEELLSSSKLDDSVRIEGNKTLEEYIKASRRRARKRLENENATKENESKRSSEVVNCKQNNVEIAITASK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.19
4 0.18
5 0.14
6 0.13
7 0.14
8 0.16
9 0.21
10 0.2
11 0.2
12 0.18
13 0.18
14 0.17
15 0.18
16 0.15
17 0.11
18 0.12
19 0.17
20 0.17
21 0.17
22 0.17
23 0.15
24 0.18
25 0.16
26 0.17
27 0.13
28 0.15
29 0.2
30 0.26
31 0.32
32 0.35
33 0.42
34 0.41
35 0.42
36 0.45
37 0.41
38 0.38
39 0.38
40 0.34
41 0.35
42 0.45
43 0.53
44 0.57
45 0.63
46 0.69
47 0.72
48 0.78
49 0.8
50 0.8
51 0.8
52 0.79
53 0.81
54 0.76
55 0.69
56 0.6
57 0.5
58 0.39
59 0.29
60 0.22
61 0.16
62 0.1
63 0.08
64 0.07
65 0.07
66 0.08
67 0.08
68 0.09
69 0.09
70 0.12
71 0.15
72 0.15
73 0.16
74 0.17
75 0.18
76 0.17
77 0.16
78 0.14
79 0.12
80 0.13
81 0.14
82 0.18
83 0.25
84 0.27
85 0.32
86 0.37
87 0.47
88 0.56
89 0.63
90 0.67
91 0.7
92 0.77
93 0.82
94 0.86
95 0.86
96 0.83
97 0.82
98 0.75
99 0.68
100 0.6
101 0.54
102 0.5
103 0.47
104 0.42
105 0.36
106 0.35
107 0.36
108 0.36
109 0.4
110 0.44
111 0.47
112 0.54
113 0.54
114 0.53
115 0.51
116 0.51
117 0.46
118 0.39
119 0.3
120 0.2