Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9D8Y5

Protein Details
Accession E9D8Y5    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MPYGHGPSHRRKGGKKKKPRENSGLSISCBasic
NLS Segment(s)
PositionSequence
8-20SHRRKGGKKKKPR
Subcellular Location(s) nucl 18.5, mito_nucl 13.166, cyto_nucl 11.333, mito 6.5
Family & Domain DBs
Amino Acid Sequences MPYGHGPSHRRKGGKKKKPRENSGLSISCRTRCLIYPSIVITWVQRTSKRMFLLRIYHLSPLTEPLTWRMTRSLSGYISRPSTSLDKIISSTGLQVTAVKSSLPQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.83
3 0.84
4 0.88
5 0.92
6 0.92
7 0.9
8 0.87
9 0.83
10 0.81
11 0.76
12 0.68
13 0.63
14 0.56
15 0.48
16 0.41
17 0.35
18 0.28
19 0.24
20 0.28
21 0.27
22 0.26
23 0.27
24 0.27
25 0.26
26 0.25
27 0.22
28 0.16
29 0.15
30 0.15
31 0.15
32 0.16
33 0.19
34 0.21
35 0.26
36 0.27
37 0.27
38 0.26
39 0.29
40 0.32
41 0.31
42 0.31
43 0.28
44 0.27
45 0.24
46 0.23
47 0.18
48 0.17
49 0.15
50 0.13
51 0.12
52 0.13
53 0.18
54 0.17
55 0.18
56 0.17
57 0.17
58 0.18
59 0.21
60 0.22
61 0.19
62 0.22
63 0.23
64 0.24
65 0.25
66 0.24
67 0.22
68 0.21
69 0.22
70 0.22
71 0.23
72 0.21
73 0.2
74 0.2
75 0.21
76 0.19
77 0.16
78 0.16
79 0.14
80 0.13
81 0.12
82 0.12
83 0.13
84 0.13
85 0.13
86 0.11