Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0B7NJA8

Protein Details
Accession A0A0B7NJA8    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
13-32SSGGKKAKKASRFNKWSAKKHydrophilic
NLS Segment(s)
PositionSequence
13-35SSGGKKAKKASRFNKWSAKKVKD
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036388  WH-like_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKKDVASKPSSSSGGKKAKKASRFNKWSAKKVKDKANNMVILDKPTYDRLFKEVPTYKLISQSVLVDRLKLNGSLARIAIRELEAQGLIKPISRHHSQIIYTRATGDDKPAKAIEVAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.49
3 0.51
4 0.53
5 0.58
6 0.62
7 0.68
8 0.74
9 0.74
10 0.74
11 0.78
12 0.8
13 0.81
14 0.79
15 0.8
16 0.79
17 0.78
18 0.77
19 0.76
20 0.78
21 0.77
22 0.76
23 0.75
24 0.72
25 0.66
26 0.57
27 0.53
28 0.44
29 0.37
30 0.31
31 0.23
32 0.17
33 0.17
34 0.18
35 0.16
36 0.15
37 0.17
38 0.19
39 0.19
40 0.25
41 0.27
42 0.28
43 0.3
44 0.31
45 0.28
46 0.3
47 0.3
48 0.22
49 0.18
50 0.18
51 0.16
52 0.18
53 0.17
54 0.14
55 0.14
56 0.15
57 0.15
58 0.13
59 0.13
60 0.1
61 0.12
62 0.12
63 0.12
64 0.12
65 0.11
66 0.11
67 0.11
68 0.1
69 0.1
70 0.09
71 0.1
72 0.09
73 0.09
74 0.09
75 0.1
76 0.09
77 0.11
78 0.11
79 0.14
80 0.19
81 0.22
82 0.24
83 0.27
84 0.31
85 0.32
86 0.39
87 0.41
88 0.38
89 0.36
90 0.34
91 0.32
92 0.3
93 0.28
94 0.29
95 0.31
96 0.29
97 0.33
98 0.32
99 0.31