Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7MU67

Protein Details
Accession A0A0B7MU67    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
69-92LRSHLAKRRFSRNRNRVYKAKKSTHydrophilic
NLS Segment(s)
PositionSequence
80-80R
Subcellular Location(s) nucl 17.5, cyto_nucl 11, cyto 3.5, mito 3
Family & Domain DBs
Amino Acid Sequences MSRCIGKFVEKNTDILNRISDKLEDSDRCEVTTTACLIAACRQYFSDFENMWSQKKYYEDLRVVLVLLLRSHLAKRRFSRNRNRVYKAKKSTTDKTCRPVSESRHMSLLKSLFLDVITSPPDSITTEQEESMSEDGDAEDDEDFLVSKNLYHYEEEEQRDLTAREINAIVAVSKMLCIYSVIVGQINPNYLKAELYKDKQDSIPPTAILLCTDVVNILQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.38
3 0.38
4 0.31
5 0.32
6 0.32
7 0.28
8 0.24
9 0.26
10 0.31
11 0.28
12 0.3
13 0.35
14 0.34
15 0.34
16 0.33
17 0.29
18 0.25
19 0.26
20 0.22
21 0.15
22 0.16
23 0.15
24 0.14
25 0.2
26 0.23
27 0.2
28 0.2
29 0.2
30 0.21
31 0.22
32 0.23
33 0.25
34 0.19
35 0.22
36 0.29
37 0.3
38 0.31
39 0.31
40 0.29
41 0.25
42 0.27
43 0.27
44 0.25
45 0.31
46 0.31
47 0.3
48 0.31
49 0.29
50 0.27
51 0.24
52 0.19
53 0.12
54 0.1
55 0.09
56 0.08
57 0.08
58 0.1
59 0.16
60 0.2
61 0.27
62 0.32
63 0.42
64 0.52
65 0.61
66 0.7
67 0.73
68 0.8
69 0.81
70 0.83
71 0.81
72 0.79
73 0.8
74 0.78
75 0.75
76 0.72
77 0.7
78 0.73
79 0.74
80 0.74
81 0.68
82 0.66
83 0.63
84 0.56
85 0.53
86 0.5
87 0.47
88 0.47
89 0.46
90 0.41
91 0.41
92 0.4
93 0.36
94 0.33
95 0.28
96 0.18
97 0.15
98 0.15
99 0.1
100 0.09
101 0.1
102 0.06
103 0.07
104 0.07
105 0.07
106 0.07
107 0.06
108 0.07
109 0.08
110 0.09
111 0.1
112 0.12
113 0.13
114 0.13
115 0.13
116 0.13
117 0.14
118 0.13
119 0.11
120 0.07
121 0.06
122 0.06
123 0.06
124 0.06
125 0.05
126 0.04
127 0.04
128 0.04
129 0.04
130 0.04
131 0.04
132 0.05
133 0.04
134 0.05
135 0.06
136 0.09
137 0.1
138 0.11
139 0.13
140 0.18
141 0.25
142 0.27
143 0.27
144 0.25
145 0.24
146 0.25
147 0.23
148 0.19
149 0.17
150 0.14
151 0.14
152 0.14
153 0.14
154 0.12
155 0.12
156 0.11
157 0.07
158 0.07
159 0.05
160 0.05
161 0.05
162 0.05
163 0.05
164 0.05
165 0.06
166 0.07
167 0.08
168 0.09
169 0.09
170 0.1
171 0.11
172 0.12
173 0.14
174 0.14
175 0.14
176 0.15
177 0.14
178 0.16
179 0.16
180 0.22
181 0.27
182 0.31
183 0.38
184 0.39
185 0.42
186 0.43
187 0.48
188 0.45
189 0.44
190 0.42
191 0.34
192 0.34
193 0.32
194 0.3
195 0.24
196 0.2
197 0.15
198 0.12
199 0.11