Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7NWA3

Protein Details
Accession A0A0B7NWA3   
Localization Confidence Low
Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
76-98GEIYNHKHLRNKLKNPHHFQTSTHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 12.833, cyto 11.5, nucl 10, cyto_pero 6.832, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017932  GATase_2_dom  
IPR029055  Ntn_hydrolases_N  
Pfam View protein in Pfam  
PF13522  GATase_6  
PROSITE View protein in PROSITE  
PS51278  GATASE_TYPE_2  
Amino Acid Sequences MCGIFAVCNYQGDVDAYRQRALYLSRKIRHRGPDWSGCHVAKNNIMCHERLAIVGVDSGAQPLVSQDGNLVLCVNGEIYNHKHLRNKLKNPHHFQTSXXXXTPITK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.21
3 0.22
4 0.23
5 0.22
6 0.22
7 0.22
8 0.25
9 0.29
10 0.33
11 0.41
12 0.46
13 0.52
14 0.56
15 0.61
16 0.64
17 0.6
18 0.59
19 0.57
20 0.6
21 0.57
22 0.59
23 0.57
24 0.49
25 0.46
26 0.4
27 0.35
28 0.29
29 0.29
30 0.25
31 0.25
32 0.26
33 0.24
34 0.23
35 0.22
36 0.18
37 0.15
38 0.14
39 0.08
40 0.07
41 0.07
42 0.06
43 0.05
44 0.05
45 0.05
46 0.04
47 0.03
48 0.03
49 0.03
50 0.05
51 0.04
52 0.04
53 0.05
54 0.07
55 0.07
56 0.08
57 0.08
58 0.06
59 0.06
60 0.06
61 0.07
62 0.05
63 0.06
64 0.09
65 0.12
66 0.21
67 0.23
68 0.27
69 0.33
70 0.4
71 0.51
72 0.58
73 0.66
74 0.68
75 0.77
76 0.84
77 0.86
78 0.86
79 0.83
80 0.74
81 0.65
82 0.65