Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7NLY5

Protein Details
Accession A0A0B7NLY5   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
9-36AFFAASNKGEKRKKKPSARSPLPSAAKAHydrophilic
NLS Segment(s)
PositionSequence
16-29KGEKRKKKPSARSP
Subcellular Location(s) nucl 14.5, cyto_nucl 9.5, mito 8, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MDTTKCSFAFFAASNKGEKRKKKPSARSPLPSAAKASATLGRLLGPQSDIPSGYRFVYFKTSLRRRLAELCRLIQAIGLNNSGVLDIQYPVLHVVSFLAHNEYVLTFTSALHKNGRGCSPLLDFDPCDPANLKDPKFDALSPVLRTQKAIEIENLRYLRSLSLVRRSVRLSVARSFLHYEQINRPQFDAILSEELKFRSSSAPAPRASSPSSDEERLAKKQRLRYLGYLLHHNTETASLLAYATSPVLSPAATADSDMADSSAAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.37
3 0.45
4 0.5
5 0.57
6 0.61
7 0.66
8 0.75
9 0.81
10 0.87
11 0.89
12 0.91
13 0.92
14 0.9
15 0.87
16 0.86
17 0.8
18 0.71
19 0.63
20 0.54
21 0.45
22 0.37
23 0.32
24 0.27
25 0.22
26 0.21
27 0.18
28 0.16
29 0.17
30 0.17
31 0.15
32 0.13
33 0.13
34 0.14
35 0.15
36 0.15
37 0.15
38 0.16
39 0.17
40 0.16
41 0.17
42 0.15
43 0.16
44 0.22
45 0.23
46 0.25
47 0.34
48 0.41
49 0.47
50 0.53
51 0.53
52 0.5
53 0.57
54 0.6
55 0.58
56 0.55
57 0.48
58 0.45
59 0.43
60 0.39
61 0.31
62 0.25
63 0.2
64 0.17
65 0.15
66 0.13
67 0.12
68 0.12
69 0.11
70 0.09
71 0.06
72 0.05
73 0.05
74 0.06
75 0.06
76 0.06
77 0.06
78 0.07
79 0.06
80 0.05
81 0.05
82 0.05
83 0.06
84 0.06
85 0.07
86 0.07
87 0.07
88 0.08
89 0.07
90 0.07
91 0.07
92 0.08
93 0.06
94 0.06
95 0.12
96 0.14
97 0.16
98 0.17
99 0.19
100 0.2
101 0.23
102 0.24
103 0.2
104 0.19
105 0.19
106 0.19
107 0.18
108 0.17
109 0.15
110 0.14
111 0.13
112 0.17
113 0.15
114 0.14
115 0.13
116 0.13
117 0.2
118 0.24
119 0.24
120 0.21
121 0.22
122 0.23
123 0.24
124 0.23
125 0.18
126 0.16
127 0.19
128 0.19
129 0.22
130 0.23
131 0.22
132 0.22
133 0.21
134 0.22
135 0.21
136 0.2
137 0.19
138 0.2
139 0.21
140 0.27
141 0.26
142 0.22
143 0.2
144 0.19
145 0.16
146 0.15
147 0.17
148 0.14
149 0.22
150 0.27
151 0.28
152 0.3
153 0.31
154 0.31
155 0.32
156 0.33
157 0.29
158 0.27
159 0.3
160 0.28
161 0.28
162 0.3
163 0.26
164 0.28
165 0.25
166 0.26
167 0.29
168 0.38
169 0.41
170 0.37
171 0.38
172 0.32
173 0.31
174 0.28
175 0.23
176 0.15
177 0.15
178 0.15
179 0.15
180 0.16
181 0.16
182 0.17
183 0.15
184 0.14
185 0.12
186 0.14
187 0.2
188 0.27
189 0.32
190 0.32
191 0.36
192 0.37
193 0.38
194 0.37
195 0.34
196 0.29
197 0.29
198 0.32
199 0.3
200 0.3
201 0.32
202 0.35
203 0.41
204 0.44
205 0.45
206 0.47
207 0.53
208 0.59
209 0.61
210 0.61
211 0.58
212 0.59
213 0.58
214 0.55
215 0.55
216 0.5
217 0.46
218 0.41
219 0.36
220 0.28
221 0.23
222 0.22
223 0.14
224 0.12
225 0.09
226 0.08
227 0.08
228 0.08
229 0.07
230 0.06
231 0.06
232 0.06
233 0.06
234 0.07
235 0.07
236 0.07
237 0.08
238 0.1
239 0.09
240 0.1
241 0.1
242 0.1
243 0.11
244 0.11
245 0.09