Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9D145

Protein Details
Accession E9D145    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
42-67CFPYMLPSRKKEKKRKLTTIARAKGEHydrophilic
NLS Segment(s)
PositionSequence
50-58RKKEKKRKL
Subcellular Location(s) nucl 11, cyto 8, mito 6
Family & Domain DBs
Amino Acid Sequences MVDDAVESLPSRVRWFAGKDSGLEKRMIPSRGRDGDAQPLFCFPYMLPSRKKEKKRKLTTIARAKGELSVLSGDDGDPHPHHCVPLFWNTPSLNLLDRWLNGRRLVDHLKGCVPFPN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.24
3 0.28
4 0.32
5 0.33
6 0.32
7 0.36
8 0.4
9 0.38
10 0.34
11 0.29
12 0.27
13 0.32
14 0.34
15 0.31
16 0.31
17 0.38
18 0.41
19 0.42
20 0.4
21 0.35
22 0.42
23 0.42
24 0.38
25 0.29
26 0.26
27 0.24
28 0.22
29 0.2
30 0.1
31 0.17
32 0.2
33 0.25
34 0.28
35 0.32
36 0.42
37 0.5
38 0.61
39 0.62
40 0.69
41 0.75
42 0.81
43 0.86
44 0.86
45 0.87
46 0.87
47 0.87
48 0.81
49 0.71
50 0.62
51 0.53
52 0.43
53 0.34
54 0.24
55 0.14
56 0.09
57 0.08
58 0.07
59 0.07
60 0.06
61 0.07
62 0.08
63 0.1
64 0.1
65 0.12
66 0.15
67 0.15
68 0.16
69 0.15
70 0.16
71 0.16
72 0.24
73 0.25
74 0.23
75 0.27
76 0.27
77 0.28
78 0.27
79 0.25
80 0.19
81 0.16
82 0.18
83 0.16
84 0.16
85 0.2
86 0.23
87 0.25
88 0.26
89 0.28
90 0.28
91 0.32
92 0.37
93 0.4
94 0.39
95 0.39
96 0.42
97 0.41