Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0B7NN37

Protein Details
Accession A0A0B7NN37    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
70-93PKTVNWRKAAARKEKRSKQQTKRSHydrophilic
NLS Segment(s)
PositionSequence
56-93RRGGAKATGKRRSAPKTVNWRKAAARKEKRSKQQTKRS
Subcellular Location(s) cyto_nucl 12.5, cyto 11.5, nucl 10.5, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
IPR000953  Chromo/chromo_shadow_dom  
IPR023780  Chromo_domain  
Pfam View protein in Pfam  
PF00385  Chromo  
PROSITE View protein in PROSITE  
PS50013  CHROMO_2  
CDD cd00024  CD_CSD  
Amino Acid Sequences FCKEHYEIQAVLDHKGSPGNDLYKVHWKGFDDPIEHTWEPVENFDSTKHIELYWGRRGGAKATGKRRSAPKTVNWRKAAARKEKRSKQQTKRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.19
3 0.17
4 0.15
5 0.18
6 0.19
7 0.21
8 0.22
9 0.25
10 0.32
11 0.35
12 0.33
13 0.32
14 0.32
15 0.33
16 0.37
17 0.37
18 0.29
19 0.28
20 0.29
21 0.34
22 0.31
23 0.27
24 0.21
25 0.19
26 0.17
27 0.16
28 0.16
29 0.09
30 0.1
31 0.1
32 0.12
33 0.11
34 0.12
35 0.11
36 0.1
37 0.12
38 0.14
39 0.19
40 0.24
41 0.24
42 0.23
43 0.25
44 0.26
45 0.25
46 0.3
47 0.32
48 0.33
49 0.41
50 0.49
51 0.49
52 0.53
53 0.6
54 0.58
55 0.59
56 0.57
57 0.57
58 0.61
59 0.7
60 0.74
61 0.69
62 0.67
63 0.67
64 0.69
65 0.69
66 0.69
67 0.69
68 0.71
69 0.79
70 0.84
71 0.87
72 0.91
73 0.92