Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0B7NKS5

Protein Details
Accession A0A0B7NKS5    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MSSSKRKYKKHGVDQVERFIKHydrophilic
61-80GTTVKPKTPKPKKLLQVHAQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20.5, mito_nucl 12, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
Pfam View protein in Pfam  
PF13384  HTH_23  
Amino Acid Sequences MSSSKRKYKKHGVDQVERFIKMLQEEGLSVPKAAAVSGIPRSSAYRILDEFNDGDGHVLPGTTVKPKTPKPKKLLQVHAQFLMALFDKNPSIVLEEVRW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.77
4 0.66
5 0.56
6 0.46
7 0.39
8 0.29
9 0.24
10 0.16
11 0.12
12 0.12
13 0.12
14 0.14
15 0.13
16 0.12
17 0.1
18 0.1
19 0.09
20 0.08
21 0.07
22 0.05
23 0.07
24 0.1
25 0.1
26 0.1
27 0.11
28 0.12
29 0.13
30 0.17
31 0.16
32 0.15
33 0.16
34 0.17
35 0.16
36 0.16
37 0.15
38 0.12
39 0.11
40 0.08
41 0.08
42 0.07
43 0.07
44 0.05
45 0.05
46 0.04
47 0.05
48 0.06
49 0.1
50 0.1
51 0.13
52 0.19
53 0.26
54 0.38
55 0.48
56 0.56
57 0.58
58 0.67
59 0.74
60 0.78
61 0.81
62 0.79
63 0.77
64 0.72
65 0.67
66 0.58
67 0.48
68 0.38
69 0.31
70 0.22
71 0.14
72 0.1
73 0.11
74 0.11
75 0.11
76 0.12
77 0.1
78 0.12
79 0.13