Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7NE89

Protein Details
Accession A0A0B7NE89   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
69-88IPPCFAPSAKANKKRKSKEIHydrophilic
NLS Segment(s)
PositionSequence
78-87KANKKRKSKE
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MRLHRGTVALLVTTKRLKMPESIEEVPALLPPVFNLVYTHAQTIKRTAAYIDDVSTSVSFGSKSELTFIPPCFAPSAKANKKRKSKEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.2
4 0.2
5 0.24
6 0.28
7 0.3
8 0.35
9 0.36
10 0.34
11 0.32
12 0.31
13 0.26
14 0.21
15 0.16
16 0.08
17 0.07
18 0.06
19 0.09
20 0.08
21 0.08
22 0.09
23 0.11
24 0.14
25 0.15
26 0.16
27 0.16
28 0.17
29 0.17
30 0.19
31 0.17
32 0.15
33 0.14
34 0.13
35 0.12
36 0.14
37 0.14
38 0.12
39 0.11
40 0.11
41 0.11
42 0.11
43 0.09
44 0.07
45 0.06
46 0.06
47 0.05
48 0.09
49 0.09
50 0.09
51 0.13
52 0.13
53 0.17
54 0.2
55 0.21
56 0.2
57 0.2
58 0.21
59 0.2
60 0.2
61 0.19
62 0.22
63 0.33
64 0.4
65 0.5
66 0.59
67 0.67
68 0.77